KEGG   Polaromonas sp. JS666: Bpro_2984Help
Entry
Bpro_2984         CDS       T00343                                 

Definition
(GenBank) amino acid/amide ABC transporter substrate-binding protein, HAAT family
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_6 Peripla_BP_5 ANF_receptor LppC DUF1917
Motif
Other DBs
NCBI-ProteinID: ABE44898
UniProt: Q128Z4
Position
3139369..3140556
Genome map
AA seq 395 aa AA seqDB search
MTSRRLVLTRSAAVIGAASTGLLLPEIVRAQSGKVRVGFMLPYTGTFAQLGVAIENGFRL
AINEQGGKLGGREIEYFKVDDESEPSKGIENASKLVQRDKVDVLVGTVHSGVQMGIQKVA
RDSGVLSLIPNAGVHAATRSLCAPNVFRTSFSNSQPTRALGQAMIAKGHKKAVWITWKYA
AGDEAFEGFKESYTAAGGTIIKELGLPFPNVEFQALLTEIAALKPDAVACFFAGGGAAKF
IRDYAAAGLKGKIPLYGSGFLTEGVLDAAGPAADGIITTMHYSDSLDTPRNKKFRLDYAK
AFKTQPDVYAVQGYDTGLLLIQGANAVKGDLANKPALYKAMEGATIDSPRGKWTMSKAHN
PVQDMYLRVVENKENKVLGVAAKALADSGAGCKMG
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atgacctcacgccgacttgttttgacccgcagtgctgccgttatcggcgccgcatccact
ggcctgctgctgcccgaaatcgtgcgcgcacagtcgggcaaggtgcgtgtgggcttcatg
ttgccctacaccggcacctttgcccaactcggggtggccattgaaaacggctttcgcctg
gcgatcaatgagcaaggcggcaagctgggcggccgcgagatcgaatacttcaaggtcgac
gatgagtccgagccgtccaaaggcattgaaaacgccagcaagctggtgcaacgcgacaag
gtcgatgtactggtcggcacggtgcactccggtgtgcagatgggtatccagaaggtcgcg
cgcgacagcggcgtactgagcctgattcccaacgcgggcgtgcatgccgccacccgcagc
ctgtgcgcacccaatgtgttccgtacctccttcagcaactcgcaacctacccgcgccctg
ggtcaggccatgatcgcaaaaggccataaaaaagccgtctggatcacctggaaatatgca
gccggcgacgaggcctttgaaggcttcaaggaaagctacacagcggccggcggcaccatt
atcaaggaactgggcctgcccttccccaacgttgaattccaggcgctgctgaccgaaatc
gccgcactcaagcccgatgccgtggcctgcttcttcgccggcggcggcgccgcgaagttc
atccgcgactacgcagcggcgggcctcaaaggcaagatcccgctctacggttccggcttc
ctgaccgaaggcgtgctggacgcggccggccctgcggcggacggcatcatcaccaccatg
cactacagcgactcgctggacacgccgcgcaacaagaaattccgcctcgactacgccaaa
gccttcaagacgcaacccgatgtgtacgcggtgcagggctatgacaccggcctgctgctg
atccagggcgccaacgccgtcaagggcgacctggccaacaagcccgcgctctacaaggcc
atggaaggcgccaccatcgacagcccgcgcggcaagtggaccatgagcaaggcacacaac
ccggtgcaggacatgtacctgcgtgtggtggaaaacaaggaaaacaaggtgctcggcgtt
gcggccaaggcactggccgactccggcgccggctgcaagatgggctag

DBGET integrated database retrieval system