KEGG   Polaromonas sp. JS666: Bpro_3004Help
Entry
Bpro_3004         CDS       T00343                                 

Definition
(GenBank) hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Lin-8
Motif
Other DBs
NCBI-ProteinID: ABE44918
UniProt: Q128X4
Position
3166906..3167223
Genome map
AA seq 105 aa AA seqDB search
MDEKTRFYVPDSVQHHTKLEWHGLFSCRLRPLPQENLMGFTEQITQNTQTEQNQQTHQNH
QPDLGRQTSQTNQSDRKDQQASHPQAGNAPWPPFQGQRQDGSTRS
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atggacgaaaagacgcggttttatgtgccggatagcgtgcaacaccacactaaattggag
tggcacgggttattttcatgccgacttcgtcccctaccgcaggagaacctcatgggattc
actgagcaaatcacgcaaaacacccaaaccgagcagaaccagcaaacccaccagaaccac
cagccggacctgggccgccagacctcccagaccaaccaaagcgacagaaaggatcagcag
gccagccatccgcaggccggcaacgccccttggccaccgttccagggtcaacggcaagat
gggtcaacccgcagctga

DBGET integrated database retrieval system