KEGG   Polaromonas sp. JS666: Bpro_3016Help
Entry
Bpro_3016         CDS       T00343                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00071  Fatty acid degradation
pol00280  Valine, leucine and isoleucine degradation
pol00281  Geraniol degradation
pol00310  Lysine degradation
pol00362  Benzoate degradation
pol00380  Tryptophan metabolism
pol00410  beta-Alanine metabolism
pol00640  Propanoate metabolism
pol00650  Butanoate metabolism
pol00903  Limonene and pinene degradation
pol00930  Caprolactam degradation
pol01040  Biosynthesis of unsaturated fatty acids
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
pol01212  Fatty acid metabolism
Module
pol_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Bpro_3016
   00650 Butanoate metabolism
    Bpro_3016
  Lipid metabolism
   00071 Fatty acid degradation
    Bpro_3016
   01040 Biosynthesis of unsaturated fatty acids
    Bpro_3016
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpro_3016
   00310 Lysine degradation
    Bpro_3016
   00380 Tryptophan metabolism
    Bpro_3016
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Bpro_3016
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Bpro_3016
   00281 Geraniol degradation
    Bpro_3016
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpro_3016
   00930 Caprolactam degradation
    Bpro_3016
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Bpro_3016
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Bpro_3016
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Bpro_3016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2 NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: ABE44930
UniProt: Q128W2
Position
3177172..3179331
Genome map
AA seq 719 aa AA seqDB search
MKTIQYALTEESFGRVATITFDEPGSPVNTMCRQWQDDLSEVTAQVLKDREAIQGVILAS
AKSTFFAGADLKAAMRLTAADASQVYAEIERVKKNFRTLETLGKPVVSCLNGAALGGGWE
LALVGHYRVAVDDSKVRFGLPEVTLGLLPGASGVTKMTRHLGLMAAQPYLVEGKTFGPRE
ALALSLVHALVPDAAALRAQALAWIAANPRAQHPWDARDYEIPGGTPASPEVAAALSVAP
AMLKKKTRGLYPAPEAILACMVEGALVDLETALRIESRYLARLMTGPNARAMINTFFFNM
NAIKSGQSRPSSVPHATPLKVGVLGAGMMGAGIAYAQASRGLATVLKDVSLDKAEAGKAY
SARLTQPQVEKGHMTPANQAALLSRITATDQLADLAGCDLIIEAVFEQRDLKAKVTQEAE
PLLAAGGFFASNTSTLPISGLAVASSRPEKFIGIHFFSPVDKMKLVEIIRGRQTDDETVA
RAFDYVQALGKIPIVVNDSRGFYTSRTFAAFVMEGAAMLGEGIPAAVIENAGMQAGMPVG
PLAVLDETALSLSVHVLDQTRADFAAEGKTYIATPGELLVERMVKEFQRNGRAEGGGFYD
YPAEKGAKKMLWPHLKALFEKSGTPWDITGIKDRLLYRQAVEAARCLSEGVLTTVAEANI
GSIFGIGFPAWTGGTLQFIYGMGLDDFIRRCDELAAKFGPGFMLTNTVRSALRKHQPVY
NT seq 2160 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatccagtacgcactgaccgaagagtcttttggccgggtggccaccattacc
tttgacgagcccggctcgcccgtcaacaccatgtgccggcaatggcaggacgacctgagc
gaagtcaccgcccaggtgctcaaggacagggaagccatccagggcgtgatcctggcctct
gccaagagcacgttttttgccggcgccgacctgaaggccgcgatgcgactgacggccgcc
gatgcgtcccaggtgtacgccgagatcgaacgggtgaagaaaaacttccgcacgctggag
accctgggcaagccggtggtgagctgcctcaacggcgcggccctgggcggcggctgggaa
ctggcgctcgtgggccactaccgtgtggcggtggatgacagcaaggtacggtttggcctg
cccgaagtcacgctgggcctgctgccgggcgccagcggcgtgaccaagatgacgcgccac
ctgggcctgatggcagcgcagccctatctggtggaaggcaagacctttggcccgcgtgaa
gcgctggcgctgagcctggtgcatgcgctggtgcccgatgccgctgcactccgcgcccag
gcgctcgcctggatagccgccaaccccagggcgcagcacccctgggacgccagggactac
gagatccccggcggaacccctgccagccccgaggttgccgcagcgctgagcgtggcgccc
gccatgctgaagaaaaagacgcgcggactctacccggccccggaagccatcctggcctgc
atggtcgaaggtgcgctggtagacctggaaaccgccttgcgcattgagagccgctacctg
gccaggctcatgaccggccccaacgccagggccatgatcaacacctttttcttcaacatg
aacgcgatcaaaagcgggcagtcgcggccgtccagcgtgccgcacgccacgcccctcaag
gtcggtgtactgggcgccggcatgatgggcgcgggcattgcgtacgcgcaggccagccgg
ggcttggccaccgtgctcaaggacgtgagcctggacaaggccgaggccggcaaggcctac
agcgccaggctcacgcagccgcaggtcgagaagggccacatgaccccggcgaaccaggca
gccctgctctcacgcatcacggcaactgaccagctggcggatctggcgggctgcgacctc
atcatcgaggcggtattcgaacaacgcgacctgaaggccaaagtgactcaggaggccgaa
ccgctgctggcggcgggcggttttttcgcgtccaacacgtccaccctgcccatctccggc
ctggcagtggccagcagccgccccgagaaattcattggcatccacttcttcagcccggtg
gacaagatgaagctggtcgagatcattcgcggccggcagaccgatgacgaaaccgtggcg
cgcgccttcgactacgtgcaggcgctgggcaagattcccatcgtggtcaacgactcgcgc
ggcttttacaccagccgcactttcgccgccttcgtgatggaaggcgcggccatgctgggc
gaaggcattccggccgcggtgattgaaaacgccgggatgcaggccggcatgccggtcggc
ccgctggcagtgctggacgaaaccgccctgtcgctgagcgtgcatgtgctggaccagacg
cgcgccgacttcgccgccgaaggcaaaacctatatcgcaacaccgggcgaattgctggtg
gaacgcatggtcaaggaattccagcgaaatggccgggccgaagggggcggtttttatgac
taccccgctgaaaagggggcgaagaaaatgctgtggccacacctcaaggcactgtttgaa
aagtccggaacaccctgggacataaccgggatcaaggaccgcctgctctaccgccaggcc
gtggaagcagcgcgctgcctcagcgaaggcgtgctgaccaccgtcgcagaagccaatatc
ggctccatcttcggcatcgggtttccggcctggaccggcggcaccctgcagttcatttac
ggcatgggcctggacgactttatccggcgctgcgatgaactggcggcaaaattcggcccg
ggctttatgctgaccaacacggtcagaagtgccctgcgcaagcaccagcccgtctactga

DBGET integrated database retrieval system