KEGG   Polaromonas sp. JS666: Bpro_3019Help
Entry
Bpro_3019         CDS       T00343                                 

Definition
(GenBank) transcriptional regulator, MarR family with acetyltransferase activity
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_1 MarR_2 MarR Acetyltransf_10 Acetyltransf_7 Acetyltransf_6 HTH_27 FR47 TrmB HTH_34 Acetyltransf_CG HTH_IclR Acetyltransf_4
Motif
Other DBs
NCBI-ProteinID: ABE44933
UniProt: Q128V9
Position
3181212..3182162
Genome map
AA seq 316 aa AA seqDB search
MSIMNLPYSPVAPDQVNAVRDFNRFYTQRIGVLDPYLGSDLSLTEVRVLYELAHRDQPTA
TELGHDLALDAGYLSRILRRFESKGWLARVPSVADARQSLLALTEAGHQVFAPLQQQSSD
EAAALLAALAPGEQQKLVNAMGTVQRLLAPATTPAPTRTIVLRDPRPGDMGWVVQQHGEI
YAREYGWNSEFEALVADIAGKYLKNFRPDSEKCWIAELDGERVGAVFVARKSATVAQLRM
LILAPQARGLGLGRRLTDECIEFARNKGYRKMQLWTNSCLDAARAIYAKRGFQLVKSEPY
HGFGHDLVGETWELRL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgtcaatcatgaacctgccgtactcccccgtcgcgccggaccaggtcaatgccgtgcgc
gacttcaatcgcttctacacccagcgcattggcgtgctcgacccttatctgggcagcgat
ctctcgctcaccgaggtacgggtgctgtacgagctggctcaccgcgaccagcccaccgcc
accgagctggggcacgacctggcactggacgcgggctacctgagccgcatcctgcgccgc
ttcgaaagcaaaggctggctggcacgcgtaccctccgtggccgacgcccggcaaagcctg
ctggcactgaccgaggccgggcaccaggtgtttgcacccttgcagcaacagtccagcgat
gaagcagcggcgctgctggcggcgctggcccccggtgagcagcaaaaactggtgaacgcc
atgggcaccgtgcagcgcctgctggcgccggccaccacgccagcgccgacgcgcaccatc
gtcctgcgcgaccccaggcccggcgacatgggctgggtggtgcagcagcacggcgaaatt
tacgcccgcgaatatggctggaacagcgagttcgaagccctcgtggccgacatcgccggc
aaataccttaaaaacttccggccggattccgagaaatgctggatcgcagaactcgacgga
gagcgggtcggcgcggtgtttgtggcgcgcaaatcagccaccgtggcccagttacgcatg
ttgatcctcgccccacaggcgcgcgggctgggcctgggcaggcgcctcacggatgaatgc
atcgagtttgcgcgcaacaagggctacaggaaaatgcagctctggaccaacagctgcctg
gacgcggcgcgggccatttacgccaagcggggcttccagctggtcaaaagcgagccctac
cacggctttgggcatgacctcgtgggtgaaacctgggagctgcggctgtaa

DBGET integrated database retrieval system