KEGG   Polaromonas sp. JS666: Bpro_3020Help
Entry
Bpro_3020         CDS       T00343                                 

Definition
(GenBank) glutamate dehydrogenase (NAD)
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00220  Arginine biosynthesis
pol00250  Alanine, aspartate and glutamate metabolism
pol00430  Taurine and hypotaurine metabolism
pol00910  Nitrogen metabolism
pol01100  Metabolic pathways
pol01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Bpro_3020
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bpro_3020
   00220 Arginine biosynthesis
    Bpro_3020
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Bpro_3020
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     Bpro_3020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_GDH ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ABE44934
UniProt: Q128V8
Position
complement(3182171..3187057)
Genome map
AA seq 1628 aa AA seqDB search
MLARTEDRVRRLFDDVMACARERLPDAAFAEFEPFLNHYYGQADAEDILSRSIADLYGAA
MAHWQFARKFSTGSVRVRVYNPTLEQHGWYSDHTVIEIVNDDMPFLVDSVTMEVNRLGLT
LHAAVHPVFRVWREAGGQIANVQAASEQGEAESNGSALESYIHLEVDRRTEAARLEELTS
GLIRVLGDVRAAVEDWPRMLETTRRTVADLVAREQAAGPAQMEAAEIAETAEARAFLEWM
ADDHFTYLGCRDYEALVRDGVYYLQGVAGSGQGILREALRDPATPDLTRLPAGVQRIVDS
PSPIFVTKANSRSTVHRPGYLDYVGVKLFDADGKLFGERRFIGLYTSIVYRVATDEIPLV
RRKIAHVMSRAGFLPRGHLAKTLLTILEQYPRDELFQIDDSELYDIALGILRLQERQRTR
LFVRRDRFDRFVSCMVFVPREKFNTDLRLRIQSLLLDAFRGVSAEFTPQLSESMLARIYI
MVRTQPGNVPEVDVRELEARIVETTHRWQDELAHALLEGCGEERGNRLLRRWGGSFPAGF
REDYAARSAVRDIELMESVQVGQQDGAPAALAMNLYRPIEAPPGSLRFKVYRAGQPVALS
QSLPMLEHLGVRVNEERPYCIEPLDAQAVWVHDFGMELVDGVEIEIDRIKALFEDVFARA
WGGEIENDDFNRLVLRAQLTWREVAILRAYARYLRQVGSTFSDAYVERALAGNPAIARKL
VELFLARFDPAQGKERDARTQKLQNDIEDALDQVPNLDEDRILRQFLGVIGATTRSNYFQ
RAADGGPKPYLSFKLDPARVPGLPEPKPMFEIWVYAPRVEGVHLRGGRVARGGLRWSDRR
EDFRTEVLGLVKAQMVKNAVIVPVGSKGGFVVKNPPPQTDRDAYMKEGIACYQTFLRGLL
DLTDNLVGAQVVPPADVVRHDADDPYLVVAADKGTATFSDYANAISAEYGFWLDDAFASG
GSVGYDHKKMAITARGAWESVKRHFRELGVDTQTSDFSVVGIGDLSGDVFGNGMLLSRHI
RLLAAFDHRHIFLDPNPDTEASFHERERLFALPRSSWADYNPALISAGGGVFARSAKTIP
LTPEVRAVLELEGDEIAPNELMRAILKAPVDLLYNGGIGTYVKASRETQPQVGDRANDAI
RINGAELRCKVVAEGGNLGCTQLGRIEYAQHGGRIYTDAIDNSAGVDCSDHEVNIKILLG
LVVADGEMTGKQRNKLLAEMTDEVGLLVLSDNTYQTQALSVANRRAAALLEPEARLIRHL
ERAGRLKRKIEFLPSDEEIDERQAARQGLTSPERAVLLAYSKMWLHDALLASDLPEDPFV
AHVLADYFPQPLRERYGDAMQHHPLKREIIATYLTNTLTNRVGATLVHQLVEETDAAPAD
IVRACIIARAVFGLEDIWQGIDALDNQVPDALQAQMLTDAGRLIERASLWFLRHRVERSA
IEQAVARFRAAADLVGPQLATLLAPADAAAQGARCDELIQAGVPAELARRVAGVDSIAAV
LDIAEVAAACERRLELVASLYFALDLHLNHGWIRERVSALPADTHWQMLARAALFDDLAA
LKRALTTSVIRLSPTLETSQALIAAWQAHNQVPLERYRRLLAEQQAVGTVDFAMLSVAMR
EMRMIEGV
NT seq 4887 nt NT seq  +upstreamnt  +downstreamnt
atgctagccagaacagaagacagagtgcggcgcctgttcgatgacgtcatggcgtgcgcg
cgcgaacgcctgccggatgcggcatttgcggagttcgaaccgttcctgaaccactactac
gggcaggccgatgcggaagacatactgagccgcagcatcgccgacctgtacggcgccgcg
atggcgcattggcagttcgcgcgcaagttctcgacaggcagcgtgcgcgtgcgtgtgtac
aacccgactctggagcagcacggctggtactccgatcacacggtgatcgagatcgtcaac
gacgacatgcccttcctggtcgattcggtgacgatggaagtcaaccggctcgggctcacg
ctgcatgcggcggtgcaccctgtgttccgggtctggcgcgaggccggtggccagatcgcg
aatgtgcaggcggccagcgagcagggcgaggccgaatccaacggttcggcgctggagtcc
tatattcacctcgaggtggatcgccggaccgaggcggcacgcctggaggagctgacgtcc
ggcctgatcagggttctgggcgacgtgcgggcggcggtggaggactggccccggatgctg
gagacgacccggcgcacggtggcggacctggttgcgcgcgagcaggcagccggcccggcg
cagatggaagccgcggaaatcgcggaaaccgcggaagccagggccttcctcgaatggatg
gccgacgaccatttcacctacctcggctgtcgcgactatgaggcgcttgtgcgggacggt
gtctactacctgcagggtgtcgcgggctccggccagggtatcctgcgcgaggccttgcgc
gacccggccacgcccgacctgacccggctgccggccggcgtgcagcgcatcgtcgactcg
ccgtcgccgattttcgtcaccaaagccaattcgcgctccactgtgcaccggccgggctat
cttgactatgtcggcgtcaagctgttcgacgccgacggcaagctgttcggggaacgccgt
ttcatcggcctctatacatcaatcgtctaccgggtcgcgaccgacgagatcccgttggtg
cggcgcaagatcgcccacgtcatgagccgcgccggctttctgcccaggggccacctggcc
aaaacgttgctcacgatactcgagcagtacccgcgcgacgagctgttccagatcgacgac
agcgaactgtatgacatcgcgctcggcatcctgcgcctgcaggagcgccagcgcacccgg
ctgttcgtgcgccgcgaccgctttgaccgctttgtgtcctgcatggtgttcgtcccgcgc
gagaagttcaataccgatttgcgcctgcggatccagagcctgctgctggacgccttccgc
ggcgtgagcgccgagttcacgccgcagctgtcggaatcgatgctggcgcgcatctacatc
atggtgcggacccagcccggcaatgttccggaagtcgatgtgcgggagctggaagcacgt
atcgttgaaaccacccaccgctggcaggacgagctggcccacgcgctgctggaaggctgc
ggagaggagcgcggcaaccggttgctgcgccgctggggcggctcgttcccggccggcttt
cgcgaggactacgcggcgcgctccgcggtgcgcgacatcgagctgatggaaagcgtgcag
gtcggccagcaagatggcgcgccggccgcgctcgcgatgaacctctatcggccgatcgag
gcgccaccgggttcgctgcgcttcaaggtctaccgcgctggacagccggttgcgttgtcg
cagagcctgcccatgctcgagcacctgggtgtccgggtgaacgaggagcgcccttattgc
attgagccgctggacgcgcaagccgtgtgggtgcacgactttggcatggagctcgtcgac
ggcgtcgagatcgagatcgaccgcatcaaggcgctgttcgaggacgtgtttgcgcgcgct
tggggcggcgaaatcgagaacgacgacttcaaccggctggtgttgcgcgcgcaactgacc
tggcgtgaagtcgcgatcctgcgcgcctatgcacgctacctgcgccaggtcggctcgacg
ttcagcgacgcctatgtcgagcgcgcgctggccggcaacccggcgatcgcgcgcaagctg
gtcgagctgttcctcgcgcgcttcgaccccgcgcaaggcaaggagcgcgacgcacggacg
cagaagctgcaaaacgacatcgaggacgcgctggaccaggtgcccaacctcgacgaggac
cgcatcctgcgccagttcctcggcgtgatcggggcgaccacgcgcagcaattatttccag
cgcgcggccgacggcgggcccaaaccctatctgtcgttcaagctcgatccggcgcgcgtg
cccggcctgccggagcccaagccgatgttcgagatctgggtctatgcgccgcgggtcgag
ggcgtgcacctgcgcggcggccgcgtcgcgcgcggagggctgcgctggtccgaccggcgc
gaggacttccgcaccgaggtgctggggctggtcaaggcgcagatggtgaagaacgcggtg
atcgttccggtcggctccaagggcggcttcgtcgtgaaaaatccgccgccccagaccgac
cgcgacgcgtacatgaaggaaggcatcgcctgctaccagaccttcctgcgtgggttgctc
gacctcaccgacaacctggtcggcgcgcaggtggtgccgcccgcggacgtggtgcgccac
gatgcggacgacccctacctggtggtcgcggccgacaagggcaccgccaccttctccgac
tacgccaacgcgatttctgccgagtatggcttctggctggacgacgcgttcgcctcgggc
ggctcggtgggctacgaccacaagaaaatggcgattaccgcgcgcggcgcctgggagtcg
gtcaagcggcatttccgggaattgggtgtcgacacccagaccagcgacttctcggtggtc
ggcatcggcgacctgtcgggcgacgtgttcggcaacggcatgctgttgtcgcgccatatc
cggctgctcgcggcgttcgaccatcgccacatcttcctcgaccccaatcccgatactgaa
gcgagctttcacgagcgcgagcgcctgttcgcgttgccgcgatcgagctgggccgactac
aaccccgcgctcatctcggctggcggcggtgtgtttgcgcgcagtgcgaagacaatcccg
ctgacgcccgaagtgcgcgcggtgctcgagctggaaggcgacgagatcgcgcccaacgag
ctgatgcgcgccatcctcaaagcgccggtcgacctgctttacaacggcggcatcggcacc
tatgtcaaggccagccgcgagacccagccccaggtcggcgaccgcgcgaacgacgcgatc
cggatcaacggcgccgagctgcgctgcaaggtggtcgccgagggcggcaacctcggctgc
acccagctcggccgcatcgagtacgcgcagcatggcgggcgcatttataccgacgcgatc
gacaattcggccggcgtcgactgctcggaccacgaggtcaacatcaagatcctgctgggg
ctggtggtcgctgacggcgagatgaccggcaaacagcgcaacaaactgctggccgagatg
accgacgaggtcggcctgctggtgctcagcgacaacacctaccagacccaggcgctgtcg
gttgcgaaccggcgcgcggccgcgttgctggagcccgaagcgcggctgatacgccacctc
gagcgcgccgggcggctcaaacgcaagatcgagttcctgccgagcgacgaggagatcgac
gagcgccaggccgccaggcagggactcacatcgcccgagcgtgcggtgctgctggcctac
agcaagatgtggctgcacgacgcgctgctggcgtctgacctgccggaagaccccttcgtc
gcccatgtactggccgactacttcccgcagccgctgcgcgagcgctacggcgacgcgatg
cagcaccatccgctcaagcgcgagatcatcgccacctacctgaccaacacgctgaccaac
cgcgtcggtgcgaccctggtgcaccagctcgtggaggaaaccgatgcagccccggccgac
atcgtgcgcgcctgcatcatcgcgcgcgctgtgttcgggctggaagacatctggcagggc
atcgatgcgctcgacaaccaggtgccggatgcgctgcaggcgcagatgctgacagacgcc
ggccggctgatagagcgtgccagcctgtggttcttgcgccaccgggttgagcgcagcgcg
atcgagcaggcggttgcgcgctttcgtgcggcagccgacctggtcgggccgcagctcgca
accctgctggcgccggccgatgcggcggcacagggcgccaggtgcgatgagttgatacag
gccggggtgccggccgaactcgcgcgtcgcgtcgcgggcgtggacagcatcgccgccgtg
ctcgacatcgcggaagtcgcggctgcctgcgagcgccggctcgaactggtcgcaagcctg
tatttcgcgctggacctgcatctgaaccacggctggatacgcgaacgcgtgagcgcgctg
ccggccgacacccactggcagatgctggcacgcgccgcgctgttcgatgacctggctgcg
ctcaagcgggcgctgacaacgagcgtgatacggctttcgccgacgctagagacgtcccag
gcgctgatcgccgcctggcaggcgcacaaccaggttccgctggagcgctaccggcgcctt
cttgctgagcagcaggcggtgggcacggtggattttgccatgctgtcagtggcgatgcgg
gagatgcgaatgatcgagggggtgtga

DBGET integrated database retrieval system