KEGG   Polaromonas sp. JS666: Bpro_3020Help
Entry
Bpro_3020         CDS       T00343                                 

Definition
(GenBank) glutamate dehydrogenase (NAD)
  KO
K15371  glutamate dehydrogenase [EC:1.4.1.2]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00220  Arginine biosynthesis
pol00250  Alanine, aspartate and glutamate metabolism
pol00430  Taurine and hypotaurine metabolism
pol00910  Nitrogen metabolism
pol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    Bpro_3020
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Bpro_3020
   00220 Arginine biosynthesis
    Bpro_3020
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    Bpro_3020
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.1  With NAD+ or NADP+ as acceptor
    1.4.1.2  glutamate dehydrogenase
     Bpro_3020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_GDH ELFV_dehydrog
Motif
Other DBs
NCBI-ProteinID: ABE44934
UniProt: Q128V8
Position
complement(3182171..3187057)
Genome map
AA seq 1628 aa AA seqDB search
MLARTEDRVRRLFDDVMACARERLPDAAFAEFEPFLNHYYGQADAEDILSRSIADLYGAA
MAHWQFARKFSTGSVRVRVYNPTLEQHGWYSDHTVIEIVNDDMPFLVDSVTMEVNRLGLT
LHAAVHPVFRVWREAGGQIANVQAASEQGEAESNGSALESYIHLEVDRRTEAARLEELTS
GLIRVLGDVRAAVEDWPRMLETTRRTVADLVAREQAAGPAQMEAAEIAETAEARAFLEWM
ADDHFTYLGCRDYEALVRDGVYYLQGVAGSGQGILREALRDPATPDLTRLPAGVQRIVDS
PSPIFVTKANSRSTVHRPGYLDYVGVKLFDADGKLFGERRFIGLYTSIVYRVATDEIPLV
RRKIAHVMSRAGFLPRGHLAKTLLTILEQYPRDELFQIDDSELYDIALGILRLQERQRTR
LFVRRDRFDRFVSCMVFVPREKFNTDLRLRIQSLLLDAFRGVSAEFTPQLSESMLARIYI
MVRTQPGNVPEVDVRELEARIVETTHRWQDELAHALLEGCGEERGNRLLRRWGGSFPAGF
REDYAARSAVRDIELMESVQVGQQDGAPAALAMNLYRPIEAPPGSLRFKVYRAGQPVALS
QSLPMLEHLGVRVNEERPYCIEPLDAQAVWVHDFGMELVDGVEIEIDRIKALFEDVFARA
WGGEIENDDFNRLVLRAQLTWREVAILRAYARYLRQVGSTFSDAYVERALAGNPAIARKL
VELFLARFDPAQGKERDARTQKLQNDIEDALDQVPNLDEDRILRQFLGVIGATTRSNYFQ
RAADGGPKPYLSFKLDPARVPGLPEPKPMFEIWVYAPRVEGVHLRGGRVARGGLRWSDRR
EDFRTEVLGLVKAQMVKNAVIVPVGSKGGFVVKNPPPQTDRDAYMKEGIACYQTFLRGLL
DLTDNLVGAQVVPPADVVRHDADDPYLVVAADKGTATFSDYANAISAEYGFWLDDAFASG
GSVGYDHKKMAITARGAWESVKRHFRELGVDTQTSDFSVVGIGDLSGDVFGNGMLLSRHI
RLLAAFDHRHIFLDPNPDTEASFHERERLFALPRSSWADYNPALISAGGGVFARSAKTIP
LTPEVRAVLELEGDEIAPNELMRAILKAPVDLLYNGGIGTYVKASRETQPQVGDRANDAI
RINGAELRCKVVAEGGNLGCTQLGRIEYAQHGGRIYTDAIDNSAGVDCSDHEVNIKILLG
LVVADGEMTGKQRNKLLAEMTDEVGLLVLSDNTYQTQALSVANRRAAALLEPEARLIRHL
ERAGRLKRKIEFLPSDEEIDERQAARQGLTSPERAVLLAYSKMWLHDALLASDLPEDPFV
AHVLADYFPQPLRERYGDAMQHHPLKREIIATYLTNTLTNRVGATLVHQLVEETDAAPAD
IVRACIIARAVFGLEDIWQGIDALDNQVPDALQAQMLTDAGRLIERASLWFLRHRVERSA
IEQAVARFRAAADLVGPQLATLLAPADAAAQGARCDELIQAGVPAELARRVAGVDSIAAV
LDIAEVAAACERRLELVASLYFALDLHLNHGWIRERVSALPADTHWQMLARAALFDDLAA
LKRALTTSVIRLSPTLETSQALIAAWQAHNQVPLERYRRLLAEQQAVGTVDFAMLSVAMR
EMRMIEGV
NT seq 4887 nt NT seq  +upstreamnt  +downstreamnt
atgctagccagaacagaagacagagtgcggcgcctgttcgatgacgtcatggcgtgcgcg
cgcgaacgcctgccggatgcggcatttgcggagttcgaaccgttcctgaaccactactac
gggcaggccgatgcggaagacatactgagccgcagcatcgccgacctgtacggcgccgcg
atggcgcattggcagttcgcgcgcaagttctcgacaggcagcgtgcgcgtgcgtgtgtac
aacccgactctggagcagcacggctggtactccgatcacacggtgatcgagatcgtcaac
gacgacatgcccttcctggtcgattcggtgacgatggaagtcaaccggctcgggctcacg
ctgcatgcggcggtgcaccctgtgttccgggtctggcgcgaggccggtggccagatcgcg
aatgtgcaggcggccagcgagcagggcgaggccgaatccaacggttcggcgctggagtcc
tatattcacctcgaggtggatcgccggaccgaggcggcacgcctggaggagctgacgtcc
ggcctgatcagggttctgggcgacgtgcgggcggcggtggaggactggccccggatgctg
gagacgacccggcgcacggtggcggacctggttgcgcgcgagcaggcagccggcccggcg
cagatggaagccgcggaaatcgcggaaaccgcggaagccagggccttcctcgaatggatg
gccgacgaccatttcacctacctcggctgtcgcgactatgaggcgcttgtgcgggacggt
gtctactacctgcagggtgtcgcgggctccggccagggtatcctgcgcgaggccttgcgc
gacccggccacgcccgacctgacccggctgccggccggcgtgcagcgcatcgtcgactcg
ccgtcgccgattttcgtcaccaaagccaattcgcgctccactgtgcaccggccgggctat
cttgactatgtcggcgtcaagctgttcgacgccgacggcaagctgttcggggaacgccgt
ttcatcggcctctatacatcaatcgtctaccgggtcgcgaccgacgagatcccgttggtg
cggcgcaagatcgcccacgtcatgagccgcgccggctttctgcccaggggccacctggcc
aaaacgttgctcacgatactcgagcagtacccgcgcgacgagctgttccagatcgacgac
agcgaactgtatgacatcgcgctcggcatcctgcgcctgcaggagcgccagcgcacccgg
ctgttcgtgcgccgcgaccgctttgaccgctttgtgtcctgcatggtgttcgtcccgcgc
gagaagttcaataccgatttgcgcctgcggatccagagcctgctgctggacgccttccgc
ggcgtgagcgccgagttcacgccgcagctgtcggaatcgatgctggcgcgcatctacatc
atggtgcggacccagcccggcaatgttccggaagtcgatgtgcgggagctggaagcacgt
atcgttgaaaccacccaccgctggcaggacgagctggcccacgcgctgctggaaggctgc
ggagaggagcgcggcaaccggttgctgcgccgctggggcggctcgttcccggccggcttt
cgcgaggactacgcggcgcgctccgcggtgcgcgacatcgagctgatggaaagcgtgcag
gtcggccagcaagatggcgcgccggccgcgctcgcgatgaacctctatcggccgatcgag
gcgccaccgggttcgctgcgcttcaaggtctaccgcgctggacagccggttgcgttgtcg
cagagcctgcccatgctcgagcacctgggtgtccgggtgaacgaggagcgcccttattgc
attgagccgctggacgcgcaagccgtgtgggtgcacgactttggcatggagctcgtcgac
ggcgtcgagatcgagatcgaccgcatcaaggcgctgttcgaggacgtgtttgcgcgcgct
tggggcggcgaaatcgagaacgacgacttcaaccggctggtgttgcgcgcgcaactgacc
tggcgtgaagtcgcgatcctgcgcgcctatgcacgctacctgcgccaggtcggctcgacg
ttcagcgacgcctatgtcgagcgcgcgctggccggcaacccggcgatcgcgcgcaagctg
gtcgagctgttcctcgcgcgcttcgaccccgcgcaaggcaaggagcgcgacgcacggacg
cagaagctgcaaaacgacatcgaggacgcgctggaccaggtgcccaacctcgacgaggac
cgcatcctgcgccagttcctcggcgtgatcggggcgaccacgcgcagcaattatttccag
cgcgcggccgacggcgggcccaaaccctatctgtcgttcaagctcgatccggcgcgcgtg
cccggcctgccggagcccaagccgatgttcgagatctgggtctatgcgccgcgggtcgag
ggcgtgcacctgcgcggcggccgcgtcgcgcgcggagggctgcgctggtccgaccggcgc
gaggacttccgcaccgaggtgctggggctggtcaaggcgcagatggtgaagaacgcggtg
atcgttccggtcggctccaagggcggcttcgtcgtgaaaaatccgccgccccagaccgac
cgcgacgcgtacatgaaggaaggcatcgcctgctaccagaccttcctgcgtgggttgctc
gacctcaccgacaacctggtcggcgcgcaggtggtgccgcccgcggacgtggtgcgccac
gatgcggacgacccctacctggtggtcgcggccgacaagggcaccgccaccttctccgac
tacgccaacgcgatttctgccgagtatggcttctggctggacgacgcgttcgcctcgggc
ggctcggtgggctacgaccacaagaaaatggcgattaccgcgcgcggcgcctgggagtcg
gtcaagcggcatttccgggaattgggtgtcgacacccagaccagcgacttctcggtggtc
ggcatcggcgacctgtcgggcgacgtgttcggcaacggcatgctgttgtcgcgccatatc
cggctgctcgcggcgttcgaccatcgccacatcttcctcgaccccaatcccgatactgaa
gcgagctttcacgagcgcgagcgcctgttcgcgttgccgcgatcgagctgggccgactac
aaccccgcgctcatctcggctggcggcggtgtgtttgcgcgcagtgcgaagacaatcccg
ctgacgcccgaagtgcgcgcggtgctcgagctggaaggcgacgagatcgcgcccaacgag
ctgatgcgcgccatcctcaaagcgccggtcgacctgctttacaacggcggcatcggcacc
tatgtcaaggccagccgcgagacccagccccaggtcggcgaccgcgcgaacgacgcgatc
cggatcaacggcgccgagctgcgctgcaaggtggtcgccgagggcggcaacctcggctgc
acccagctcggccgcatcgagtacgcgcagcatggcgggcgcatttataccgacgcgatc
gacaattcggccggcgtcgactgctcggaccacgaggtcaacatcaagatcctgctgggg
ctggtggtcgctgacggcgagatgaccggcaaacagcgcaacaaactgctggccgagatg
accgacgaggtcggcctgctggtgctcagcgacaacacctaccagacccaggcgctgtcg
gttgcgaaccggcgcgcggccgcgttgctggagcccgaagcgcggctgatacgccacctc
gagcgcgccgggcggctcaaacgcaagatcgagttcctgccgagcgacgaggagatcgac
gagcgccaggccgccaggcagggactcacatcgcccgagcgtgcggtgctgctggcctac
agcaagatgtggctgcacgacgcgctgctggcgtctgacctgccggaagaccccttcgtc
gcccatgtactggccgactacttcccgcagccgctgcgcgagcgctacggcgacgcgatg
cagcaccatccgctcaagcgcgagatcatcgccacctacctgaccaacacgctgaccaac
cgcgtcggtgcgaccctggtgcaccagctcgtggaggaaaccgatgcagccccggccgac
atcgtgcgcgcctgcatcatcgcgcgcgctgtgttcgggctggaagacatctggcagggc
atcgatgcgctcgacaaccaggtgccggatgcgctgcaggcgcagatgctgacagacgcc
ggccggctgatagagcgtgccagcctgtggttcttgcgccaccgggttgagcgcagcgcg
atcgagcaggcggttgcgcgctttcgtgcggcagccgacctggtcgggccgcagctcgca
accctgctggcgccggccgatgcggcggcacagggcgccaggtgcgatgagttgatacag
gccggggtgccggccgaactcgcgcgtcgcgtcgcgggcgtggacagcatcgccgccgtg
ctcgacatcgcggaagtcgcggctgcctgcgagcgccggctcgaactggtcgcaagcctg
tatttcgcgctggacctgcatctgaaccacggctggatacgcgaacgcgtgagcgcgctg
ccggccgacacccactggcagatgctggcacgcgccgcgctgttcgatgacctggctgcg
ctcaagcgggcgctgacaacgagcgtgatacggctttcgccgacgctagagacgtcccag
gcgctgatcgccgcctggcaggcgcacaaccaggttccgctggagcgctaccggcgcctt
cttgctgagcagcaggcggtgggcacggtggattttgccatgctgtcagtggcgatgcgg
gagatgcgaatgatcgagggggtgtga

DBGET integrated database retrieval system