KEGG   Polaromonas sp. JS666: Bpro_3023Help
Entry
Bpro_3023         CDS       T00343                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: ABE44937
UniProt: Q128V5
Position
complement(3189543..3190352)
Genome map
AA seq 269 aa AA seqDB search
MSTVSYDSPTERVQTWLDASTLHIRFNNPARHNALSVDMWEAVPPLLAQAETDDRVRLVV
FSGAGEKAFVSGADISQFEDMRAAREAVTRYEHMAENALMSIHNFSKPTLSCIRGFCIGG
GVNVAISCDIRIASTDSVFSIPAARLGLGYRYSAMKNLVDLIGPGAAKDLFFTARKIDAH
EAKSLGLISRACAPDELPALLAEYTSALAANAPLTVRAGKAITAEILKPSPELDLDLCQR
LIRGCFDSADYAEGRKAFMEKRKPAFTGK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgtgagttatgactcccccaccgaacgcgtgcagacctggctggacgcctcc
acgctgcatatccgctttaacaatccggcccgccacaacgcgctgtcggtcgacatgtgg
gaggccgtcccgcccttgctggcacaggccgaaaccgacgaccgggtgcgtctggtggtg
ttctcgggcgccggcgagaaagcctttgtgtcgggcgccgacatctcgcaatttgaggac
atgcgtgccgcccgggaagcggtgacccgttatgagcacatggcggaaaacgccctgatg
agcatccacaatttcagcaagcccacgctgtcgtgcatccgcggcttttgcatcggcggc
ggtgtgaatgtggcgatcagctgcgacatccgcatcgcctcgaccgattcggtgttttcg
attcccgcagcccgcttgggcctgggttaccgctactcggccatgaaaaacctggtcgac
ctgatcggcccgggtgcggccaaggacctgttcttcaccgcccgcaagattgacgcccac
gaggccaaatcgctgggcctgatctcgcgcgcctgcgcacccgacgagctgcctgcgctg
ctggcggaatacacctcggcgctggccgccaatgcgcccctgaccgtgcgcgcgggcaag
gccatcacggctgaaatcctcaagccctcacccgagctggacctggacctgtgccagcgc
ctgattcgcggctgctttgacagcgccgactatgccgaggggcgcaaagccttcatggaa
aaacgcaaaccggcttttaccgggaaataa

DBGET integrated database retrieval system