KEGG   Polaromonas sp. JS666: Bpro_3024Help
Entry
Bpro_3024         CDS       T00343                                 

Definition
(GenBank) L-carnitine dehydratase/bile acid-inducible protein F
  KO
K07749  formyl-CoA transferase [EC:2.8.3.16]
Organism
pol  Polaromonas sp. JS666
Brite
KEGG Orthology (KO) [BR:pol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bpro_3024
Enzymes [BR:pol01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.3  CoA-transferases
    2.8.3.16  formyl-CoA transferase
     Bpro_3024
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CoA_transf_3
Motif
Other DBs
NCBI-ProteinID: ABE44938
UniProt: Q128V4
Position
complement(3190352..3191602)
Genome map
AA seq 416 aa AA seqDB search
MGDTFASFVCFYCSFCSGYSMPHLPASSALQRFRVVDLTQVRAGPTACRQLADWGADVIQ
VQMPEHMRGDDTLGGQEGSDYQYTHRNKRSITLNLKEEEGISVLKRLIGGADVVVENFRP
DVKFRLGIDYETLRVDNPRLVYASISGFGQSGPLAARPGFDQIAQGMGGLMSVTGLAEQG
PMRVGIPIADLCAGIFAAQGILVALLERETSGKGQWLHTSLLESMVYMMDFQTSRWLIDG
EVATQAGNFHPTSIPTGVYKARDGYMNIAVFGSRIWERFCEILGAPQWVSDERYKDKMGR
SVNRDSLNAEINRLLAAQDRAYWIERLNVGGVACGLINSMQEAFEEPQIKHLNMVKDVVS
AHLGAQRLVGQPMQLERTPSTIARAAPRRGEHTEEILTELGLSAGDLARMKSTGVY
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggagacactttcgcttcgtttgtctgtttttactgctctttctgttctggatattcc
atgcctcacctgccagcctcttccgcactccagcgctttcgcgtggtggatctcacccag
gtccgggccggcccgacggcctgccgccagctggccgattggggcgccgacgtcatccag
gtccagatgcccgagcacatgcggggcgatgacacgcttggcgggcaggaaggctccgac
taccagtacacccaccgcaacaagcgctcgatcaccctcaacctgaaagaggaggagggc
atcagcgtgctcaagcgtctgattggcggggccgacgtggtggtggagaacttccggcct
gacgtgaagttccgcctcggcatcgactacgaaaccctgcgcgtcgacaacccgcgcctg
gtgtacgccagcatctccggctttggccagtcgggccccctggccgcccgccccggtttt
gaccagattgcgcaaggcatgggcggcctgatgtcggtgaccggcctggctgagcagggg
ccgatgcgcgtgggcattcccatcgcagacctgtgcgccggcatttttgcggcccagggc
atcctggtggcgctgctggagcgcgaaacctcgggcaagggccagtggctgcacacgtcc
ttgctggagtccatggtctacatgatggacttccagacctcgcgctggctgatcgacggc
gaagtcgccacccaggccggcaactttcaccccaccagcattccgaccggggtgtacaag
gcgcgcgacggttacatgaacatcgcggtgttcggctccaggatatgggagcgcttttgc
gagatcctgggcgcgccccaatgggtcagcgacgagcgctacaaggacaagatgggccgc
tcggtcaaccgcgattcgctcaacgccgaaatcaaccggctgctggcggcgcaggaccgc
gcctactggatcgagcgcctgaatgtgggcggcgtggcctgcggcttgatcaacagtatg
caggaggcctttgaggagccgcagatcaagcacctcaacatggtcaaggacgtggtgtct
gcccatctgggcgcccagcgcctggtgggccagcccatgcagctggagcgcacgcccagc
accatcgcccgtgccgcgccgcgccgtggcgagcacaccgaggaaatcctgaccgaattg
ggtttaagcgccggcgatctggcgcgcatgaaatcaactggagtgtattga

DBGET integrated database retrieval system