KEGG   Polaromonas sp. JS666: Bpro_3025Help
Entry
Bpro_3025         CDS       T00343                                 

Definition
(GenBank) transcriptional regulator, GntR family
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FCD GntR UPF0561
Motif
Other DBs
NCBI-ProteinID: ABE44939
UniProt: Q128V3
Position
3191739..3192416
Genome map
AA seq 225 aa AA seqDB search
MTSLKEKPEQGLPLFIAEELKHLIYTGALKPGERLNEAALALRMGTSRGPIREAIRVLTG
LGIVKAVVNRGVFVRQISVREMLEIYELRALVFGFAAERATEHINEEHKQQFERLLAQMD
AACDAEDADLYYDLNLQFHALILRLSNNQRAHETYDDYVKELHLFRRRYFNSPGNMRRSN
IEHRSIYEAIVKGAKARAKSAAERHVLSGRERLLASIDDSSPLSS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgacctcactcaaagaaaaacctgaacagggactgccgcttttcattgcggaagagctc
aagcacctgatctacaccggcgcactcaagcccggcgagcgcctcaatgaagcggcgctg
gcgctgcgcatgggcaccagccgcggcccgatccgggaggccatccgcgtgctgacgggc
ctgggcatcgtcaaggcggtggtcaaccgcggcgtcttcgtgcggcagatttcagtgcgc
gagatgctggagatctacgaactccgggcgctcgtcttcggcttcgccgccgaacgggcc
acggaacatatcaacgaagagcacaagcagcagtttgagcggctactcgcgcagatggat
gcagcctgcgacgctgaagacgccgatctgtactacgacctgaacctgcaattccatgcg
ctgatcctgcgcctgtccaacaaccagcgggcccatgaaacatatgacgactatgtcaag
gagctgcacctgttcaggcggcgctacttcaactcgcccggcaacatgcggcgctccaac
atcgagcaccggagcatctacgaggccatcgtcaaaggggccaaagcccgggcgaaatcg
gccgctgaacgccatgtgctgtcgggacgggaacgcctgctggccagcatcgatgacagc
agccccctgtcgtcctag

DBGET integrated database retrieval system