KEGG   Polaromonas sp. JS666: Bpro_3028Help
Entry
Bpro_3028         CDS       T00343                                 

Definition
(GenBank) hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1189
Motif
Other DBs
NCBI-ProteinID: ABE44942
UniProt: Q128V0
Position
complement(3193670..3194023)
Genome map
AA seq 117 aa AA seqDB search
MNFRYLIAPVLIAVGVLTMLASCTQEQQNKISRDIQNWTGTNGVLEFYAGDKLMRRFIKI
DKLSTAMGTDDGKARSYRFGYGVLDENLNMVVDAGEKKVYFEVSDYGSNYIFFENPR
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atgaatttccggtacttgattgctcctgttttaatagctgtcggtgtgttaaccatgctg
gcttcctgtacccaggagcagcaaaacaagatcagccgcgacatccagaactggaccggc
accaatggcgttctggagttttatgcgggcgacaagctgatgcgccgcttcatcaagatt
gacaaactgagcaccgccatgggcaccgatgacggcaaggcgcgctcctaccggtttggg
tatggcgtgctggatgaaaacctgaacatggttgtcgacgccggcgaaaagaaggtgtat
ttcgaggtcagcgattacggctcaaactacatctttttcgagaatccccgctaa

DBGET integrated database retrieval system