KEGG   Polaromonas sp. JS666: Bpro_3030Help
Entry
Bpro_3030         CDS       T00343                                 

Definition
(GenBank) ABC transporter related protein
  KO
K02003  putative ABC transport system ATP-binding protein
Organism
pol  Polaromonas sp. JS666
Module
pol_M00258  Putative ABC transport system
Brite
KEGG Orthology (KO) [BR:pol00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pol02000]
    Bpro_3030
Transporters [BR:pol02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative ABC transporter [MD:M00258]
    Bpro_3030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 AAA_29 SMC_N RsgA_GTPase AAA_30 AAA_25 AAA_23 AAA_28 MMR_HSR1 FtsK_SpoIIIE AAA_16 NACHT Herpes_Helicase AAA_22 DUF87
Motif
Other DBs
NCBI-ProteinID: ABE44944
UniProt: Q128U8
Position
complement(3194948..3195550)
Genome map
AA seq 200 aa AA seqDB search
MRDIDFSLAPRETAAIVGASGSGKSTLLSIIAGLDTPSQGTVRMAGQDLFALNEDDRAAL
RARKVGFVFQSFQLMGNLTALENVMLPLELADQRNARALATDMLKRVGLGERLGHYPKVL
SGGEQQRVALARAFVVQPAVLLADEPTGSLDFATGETVMALMFELNQELGTTLVLVTHDP
MIAARCERRITIDAGRIVKA
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcgatattgatttctccctggcgccccgggaaactgccgctattgtcggtgcctcc
ggctccggcaaaagcacgctgctgtccatcatcgccgggctcgacacgccgtcccagggc
acggtgcggatggcggggcaagacctgtttgccctcaatgaggatgaccgcgcggccctg
cgcgcccgcaaagtgggttttgtcttccagagcttccagctcatgggcaatttgacggcg
cttgaaaacgtcatgttgccgctggagctggccgatcagcgaaatgcccgcgcgctggcg
accgacatgctcaagcgggtcggcttgggcgagcggctgggccattatcccaaagtgctg
tcgggcggcgagcagcagcgcgtggcactggcgcgggccttcgtggtgcagcccgccgtg
ctgctggccgacgagccgaccggcagccttgacttcgccaccggcgaaaccgtgatggcg
ctgatgtttgaactcaaccaggaactgggcacgacgctggtgctggtcacgcacgacccg
atgatcgccgcacgctgcgagcggcgcatcaccattgatgccgggcggatcgtcaaggct
tga

DBGET integrated database retrieval system