KEGG   Polaromonas sp. JS666: Bpro_3033Help
Entry
Bpro_3033         CDS       T00343                                 

Definition
(GenBank) DnaB-like protein helicase-like protein
  KO
K02314  replicative DNA helicase [EC:3.6.4.12]
Organism
pol  Polaromonas sp. JS666
Pathway
pol03030  DNA replication
Brite
KEGG Orthology (KO) [BR:pol00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    Bpro_3033
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:pol03032]
    Bpro_3033
Enzymes [BR:pol01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Bpro_3033
DNA replication proteins [BR:pol03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    Bpro_3033
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DnaB_C DnaB AAA_25 LAGLIDADG_3 Hom_end
Motif
Other DBs
NCBI-ProteinID: ABE44947
UniProt: Q128U5
Position
complement(3197478..3199943)
Genome map
AA seq 821 aa AA seqDB search
MSAVLSAYNDPGYSADRQIAQLRIPPHSIEGESSVLGGLLLDNGAWDRVGDLLTDEDFYR
HEHKLIYAAVGALINASKPADIITVYEHLQNQGKADEVGGLGYLNSLAQYVPSASNIRRY
AEIVRERSILRKLVSASDEISTNAFNPQGKDVATILDEAEQKIFKIGEQGSRMKEGFQSM
DTLVVSLLDRVTEMAENPQDVTGVPTGFYDLDRMTSGFQAGDLVILAARPSMGKAQPLDA
RVRTRTGWSTMGDLAVGDALASVDGQPSIVTAVFPQGEKEVFRISFSDGRSTECCAEHLW
QVQYREWDVPRVVNTTRLSVMLQCKRYMNRLWVEPASGEFGHEDPVPIDPWVLGGLLGDG
CLTGAGTVRFSTAAPQMLALMSEGLGQGMSLNHAGRYDWRIARQNGAHAKGVAGVQSNPL
RLGLQALGLSGLPSDRKFIPRIYLEAQKTVRLGVLRGLLDTDGWVEKWGSVRFSTASHQL
AKDVQELVRSLGGWCSINQKQPYFTNVAGMRMAGLPAYVCNISHPEPKTLFSLAEKVARA
PAQWQRAKRLTVSSITPTRKALCQCISVSHPSKLYITDQDVVTHNTALAINIAEHVALNE
GLPVAVFSMEMGASQLAVRIVGSIGRIDQTHLRTGALTDEEWPRLTEAIEKLRTVSLHID
ETPGLTVSELRANARRLARQCGKLGLIVVDYLQLMSVSTSMNDENRATAVGEISRGLKML
AKELQCPVIALSQLSRGVESRTDKRPMMSDLRESGAIEQDADIIMFIYRDEYYTKEACKE
PGVAEVIISKQRNGPTGTVKLAFINRITKFESLASGSSGDF
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccgtactttctgcctacaacgaccccggctacagcgccgatcggcaaatcgcc
cagctgcgcattccgccgcactccatcgaaggcgaatccagcgtactgggcggcctgctg
ctcgacaacggcgcctgggaccgtgtgggcgacctgttgaccgatgaagacttctatcgc
cacgagcacaaactgatttacgccgctgttggcgcgctcatcaacgcttccaagccggcc
gacatcatcacggtctacgagcacctgcagaaccagggcaaggctgacgaggtgggcggc
ctgggctacctgaattcgctcgcgcaatacgtgcccagcgccagcaacatccgccgctat
gcggagatcgtgcgcgagcgctccatcctgcgcaagctggtgtcggcctccgacgagatc
tccaccaacgccttcaacccacagggcaaggacgtcgccaccatcctcgacgaggccgag
cagaagattttcaagattggcgagcagggctcgcgcatgaaggaaggcttccagagcatg
gacacgctggtggtcagcctgctcgaccgcgtgaccgaaatggccgagaacccgcaggac
gtcaccggcgtgcccacgggcttctacgatctggaccgcatgacctccggcttccaggcc
ggtgatctggtgattcttgccgcccgcccatcgatgggaaaagcgcagcccctggatgcc
cgcgtgcgcacccgcacgggctggagcacgatgggcgatttggctgtgggggacgcgctg
gcttccgttgatgggcaaccatccatagtgacagccgtatttccgcagggagagaaagag
gtttttcgtatcagtttttctgacggtcgcagcaccgaatgttgcgccgaacacctgtgg
caggtgcaataccgcgagtgggatgtacccagagtggtcaatacgaccagactgtctgta
atgcttcaatgcaaacggtatatgaatcgtttgtgggtcgagccagcctccggtgaattt
ggccatgaagatcctgttccgattgatccctgggttctgggcggtttgttgggcgatggg
tgcctgactggagcgggcacagtgcgcttttccacagctgcgccgcaaatgctggcgctc
atgtctgagggcttggggcaagggatgtcgctaaaccatgcgggacgctatgactggcgc
attgcgcggcagaatggcgcccacgccaaaggggtagccggggtgcagtccaatccgttg
cggttgggtttgcaggcgctgggtttgtcgggattgccgagcgacagaaaattcattcca
cgcatctaccttgaagcacaaaaaaccgtgcgccttggcgtgttgcgggggttgcttgac
accgatggatgggtcgaaaaatgggggagcgtgcggttttctaccgccagtcatcaactg
gcgaaggatgttcaggaacttgtgcgctcattgggtggctggtgttccatcaaccaaaag
cagccgtacttcaccaatgtcgcagggatgcgcatggcgggtttaccagcctatgtctgc
aacatttcccacccagaaccaaagactttgttttcattggctgaaaaagttgcaagggca
cccgcccaatggcagcgcgcaaagcgtctgactgtttcgtccatcacgccaacccgcaaa
gcgctctgccagtgcatttcggtcagccaccccagcaagctctacatcaccgatcaggac
gtggtgacccacaacaccgcactggccatcaacatcgccgagcatgtggcgctgaacgaa
ggcctgccggtggcggtgttctccatggagatgggagcctcccagctcgccgtgcgtatc
gtcggctccatcggccgcattgaccagacccatttgcgcaccggtgccctgaccgacgaa
gagtggccgcgtttgaccgaagccattgaaaagctgcgcaccgtctcgttgcacattgac
gaaacacccggtctcacggtgagcgagcttcgcgccaacgcgcgccgcctggcccgccag
tgcggcaagctcggtttgatcgtggtcgattatttgcagctcatgagcgtgtcgaccagc
atgaacgacgagaaccgcgcgacggccgtcggcgaaatttcacgtggcctgaaaatgctg
gccaaggaactgcaatgccccgtgattgccctgtcacagctcagccgtggcgtagagtct
cgcaccgacaagcgtcccatgatgagcgacctgcgtgagtccggcgccatcgagcaggac
gccgacatcatcatgttcatctaccgcgacgagtactacaccaaggaggcctgcaaggag
ccgggtgtggccgaggtcatcatcagcaagcagcgtaacggccccacgggtacggtgaag
ctggcgtttatcaaccgcatcaccaagtttgagagtctggccagcggatcgagcggggat
ttctag

DBGET integrated database retrieval system