KEGG   Polaromonas sp. JS666: Bpro_3036Help
Entry
Bpro_3036         CDS       T00343                                 

Definition
(GenBank) putative primosomal replication protein
  KO
K02686  primosomal replication protein N
Organism
pol  Polaromonas sp. JS666
Pathway
pol03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:pol00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Bpro_3036
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:pol03400]
    Bpro_3036
DNA repair and recombination proteins [BR:pol03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Bpro_3036
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SSB
Motif
Other DBs
NCBI-ProteinID: ABE44950
UniProt: Q128U2
Position
complement(3200871..3201170)
Genome map
AA seq 99 aa AA seqDB search
MNHVELTACIAEASPLRYTPAGIPAANFVLEHESEIVEAGVARQVKLTVRAVAFGTLAEQ
SAKSPLGKPFRFTGFLINARTSKGVVFHIQAIDQVLNPI
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
gtgaaccacgttgaactgaccgcctgtatcgccgaggccagtcctcttcgctacacgccc
gctggaatccccgccgccaatttcgtcctcgaacacgagtccgaaatcgtcgaagcaggt
gttgccagacaggtcaaattgacggtcagggcggttgccttcggaacgctggctgagcaa
tcagccaagtccccgctaggcaagcccttcaggttcaccgggttcctcatcaatgcgcgc
accagcaaaggcgttgtttttcatattcaagcaatcgatcaagtactgaatcccatttaa

DBGET integrated database retrieval system