KEGG   Polaromonas sp. JS666: Bpro_3058Help
Entry
Bpro_3058         CDS       T00343                                 

Definition
(GenBank) Glyoxalase/bleomycin resistance protein/dioxygenase
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyoxalase Glyoxalase_4 Glyoxalase_2
Motif
Other DBs
NCBI-ProteinID: ABE44972
UniProt: Q128S0
Position
3223466..3223876
Genome map
AA seq 136 aa AA seqDB search
MELRICIDVDDMERAIAFYTGGLGLHVGRRFKSDFVEILGAGSPIDLLLNAAGTQPVANS
TGTRHYGRHWTPVHLDFVVQDIEAAVRRLQAHGAVLEMPVAERAWGRIAGLADPFGHGLD
LLEFRGRGYDEIMQTS
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggaactgcgtatctgcatcgatgtggatgacatggaacgggccatcgcgttttacacc
ggtggcctgggcctgcatgtcggccgccgtttcaagagcgatttcgtggaaattctgggt
gcaggcagcccgatagacctgctgctcaatgccgcgggcacccagccagtggccaacagc
accggcacgcggcactacggccgccactggacgcccgtgcacctggactttgtggtccag
gacattgaggcggctgtccgaagactgcaggcccatggtgcagtcctggaaatgccggtg
gccgagcgcgcgtggggccgaattgccgggctggcagacccttttggccacgggctggat
ctgctcgaattcaggggacgaggttacgacgaaataatgcaaacgtcgtga

DBGET integrated database retrieval system