KEGG   Polaromonas sp. JS666: Bpro_3063Help
Entry
Bpro_3063         CDS       T00343                                 

Definition
(GenBank) response regulator receiver domain protein (CheY-like)
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg
Motif
Other DBs
NCBI-ProteinID: ABE44977
UniProt: Q128R5
Position
3228028..3228471
Genome map
AA seq 147 aa AA seqDB search
MSTPTMLVVEDNTDHLELTLTTLQQNGVPHDIVIARDGREALDYLFCEGVYKDRNANSQP
ELVLLDLGLPKLSGLEVMRRMREDPRTFFVPVVMLTLVSEQSEAVRAFKGGLNSYVSKPL
DYRDFEEKLQQVREYWRTSNFAPLTII
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaccgacgatgctggtggtagaggacaataccgaccacctcgaattgaccttg
accacgctgcaacaaaacggggtgcctcatgacatcgtgatcgcccgggatggacgcgag
gccctcgactatttattttgcgagggtgtttataaagaccgcaacgccaacagccagccc
gaactggtcctgctggatctggggctgcccaagctgagcggcctggaggtgatgcggcgc
atgcgggaggatccccggacgttttttgttccggtcgtgatgctgaccctggtgagcgag
caatccgaggcggtgcgcgcattcaaaggcgggctcaacagctacgtgagcaagccgctc
gactaccgtgactttgaggaaaagctccagcaggtccgggaatattggcgcacctccaac
ttcgcaccgcttaccatcatctga

DBGET integrated database retrieval system