KEGG   Polaromonas sp. JS666: Bpro_3064Help
Entry
Bpro_3064         CDS       T00343                                 

Definition
(GenBank) PpiC-type peptidyl-prolyl cis-trans isomerase
  KO
K03770  peptidyl-prolyl cis-trans isomerase D [EC:5.2.1.8]
Organism
pol  Polaromonas sp. JS666
Brite
KEGG Orthology (KO) [BR:pol00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:pol03110]
    Bpro_3064
Enzymes [BR:pol01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     Bpro_3064
Chaperones and folding catalysts [BR:pol03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    Bpro_3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SurA_N_3 Rotamase_3 Rotamase Rotamase_2 SurA_N_2 SurA_N
Motif
Other DBs
NCBI-ProteinID: ABE44978
UniProt: Q128R4
Position
complement(3229184..3231115)
Genome map
AA seq 643 aa AA seqDB search
MFDFIRKHTKVTMALLFLLIVPSFILFGLDGYNRSREQGVAVARVDGKDIIQSEWDRAHQ
LEVDRLRASMPSLDAKLLDSPQARYATLERLVRDRVIAAAADKFKLVISDQRLARELQQS
SEIASLRRSDGNLDMERYRQVLGSQGMSPEMFEANVRADLSNRQVLTGIGASGFSSSSAA
DLALNAYFEKREIQLARFNAADFAAKLSPTDADLDQFYKANEKLFQAPEQASIEYVMLDV
ETVRKSITINEADLKTYYEQNLQRLSGAEERRASHILITSPKTASAEERQKAKAKAEELL
AAVKKSPDTFADVARKNSQDPGSAPSGGDLDFFARGAMVKPFEDAVFSMKKGDISAVVES
EFGYHIIRLTDIKAPKQRSFEEMKPELEADLKKQQAQKKFSEAAEAFTNGVYEQAGSLKP
VAERLKLDIKTASNVTRQPSAGTTGVLANPKFLNALFGPDAVEKKRNTEAIEVAPSQLVS
GRILQYTPARTQPFAEVKDIVRQRWLAQRSAEEARKEGLAKLVAWKAAPASAVLAAPVLV
SREQTQNLPVQVIDAALRVDASALPVFAGVDLGAQGYAIVKVAKVMPRDARPDAAAKQER
NQYAQWWTSAENLAYYNGLKERFKAEILVAKPASVNADEVVTQ
NT seq 1932 nt NT seq  +upstreamnt  +downstreamnt
atgtttgatttcattcgcaagcacaccaaagtcaccatggccttgctgtttttgctgatt
gttccgtcgtttattttgtttggcctcgatggctacaaccgatcgagggaacaaggcgtg
gcggttgccagggtggatggaaaagacatcatccagtccgagtgggaccgcgcgcatcag
ctggaagttgacagattgcgggcttccatgccttcgctggatgccaagctgctggattca
ccgcaggcccgttatgccacgctggagcgcctggtgcgcgatcgcgtgatcgccgccgcg
gccgacaaattcaagcttgtcatcagtgaccagcgtctggcccgcgaactgcagcagagt
tccgagattgcgtcactgcgccgctctgatggcaacctcgacatggagcgctatcgccag
gtgctgggcagccagggcatgagccccgagatgttcgaggccaatgtgcgggccgatctg
tcgaatcgccaggtgctgacgggcattggcgccagcggtttttcttccagctccgcggcc
gacctggcgctcaacgcctatttcgaaaaacgagaaattcagcttgcccgtttcaatgcg
gctgatttcgcggcgaagctcagccctacagatgccgatctcgatcagttctacaaggcg
aacgaaaaactctttcaggcgccggagcaggcgagtatcgagtacgtgatgctggacgtg
gagacggtcaggaaaagtatcacgatcaatgaggcggacctgaagacctattacgagcag
aacctccagaggctcagtggcgccgaagagcggcgagccagccatatcctcattacctcg
cccaagacagcgtctgccgaggaacgccagaaggccaaggccaaggccgaggagctgctg
gctgccgtcaaaaaatctcccgatacctttgccgacgtggcgcgcaagaattcgcaggac
ccgggttccgcacccagtggtggcgatctcgatttctttgcccggggcgccatggtcaag
ccgtttgaagatgccgtgttctcgatgaaaaaaggggacatcagtgctgtggtggagtcc
gagtttggctaccacatcatcaggctcaccgacatcaaggcacccaagcagcgcagtttc
gaagagatgaagcccgagctggaagccgacttgaagaagcagcaagcccagaagaagttt
tctgaagccgcagaagccttcaccaatggcgtgtatgagcaggcgggcagcctcaagccg
gttgcggagcgcctcaagctggatatcaagacggccagcaacgtgacgcgtcaaccgtca
gcaggtactacgggtgtgctcgccaatccgaaattcctcaatgcactgtttgggcccgat
gcggtcgagaaaaagcgcaataccgaagccattgaagtggcacccagccaactggtttcg
ggccgcatcctccagtacaccccggcgcgtacccagccttttgcagaggtgaaagacatc
gtgcgccagcgctggctggctcaacgtagtgcagaagaagctcgcaaggaaggtctcgcc
aaactggtggcctggaaggccgctccggcttcggccgtgctggcagcgccggtgctggtg
tcgcgtgagcaaacccagaacctgccggttcaggtgattgatgctgccctgcgcgttgac
gccagtgcactgccggtgtttgcgggcgttgacctgggtgcccagggctatgccatcgtg
aaggtcgctaaagtgatgccccgcgatgcgcgacctgacgccgcagccaaacaggagcgc
aaccagtacgcccaatggtggacgtctgccgagaatctggcttattacaacggcctgaag
gaacgtttcaaggcggaaatcctggtcgcaaagcccgcatccgtgaatgcagacgaggtc
gtgacgcaataa

DBGET integrated database retrieval system