KEGG   Polaromonas sp. JS666: Bpro_3069Help
Entry
Bpro_3069         CDS       T00343                                 

Definition
(GenBank) protein of unknown function DUF6, transmembrane
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EamA
Motif
Other DBs
NCBI-ProteinID: ABE44983
UniProt: Q128Q9
Position
complement(3235049..3235930)
Genome map
AA seq 293 aa AA seqDB search
MPAVFVLIWSTGFIVAKYGLPYAPPLTFLAIRYFLSIACFLIWIALARASWPREGRQWLH
LAVTGVLMQAGYLGGVWVAVKAGMGSGLTALIVGLQPVLTALWVSWMASGDTRQQGSTVT
SRQWMGLALGLGGLLLVVSHKLGGGHEVTALTLTATLFALFSITVGTLYQKRFVKPADVR
CAGAVQMGAALLVTLPLVFFETGAIVWNHQFVGAMAWSVLVLTLGGSSLLYLLIQRGAAT
SVTSLLYLVPPTTALMAWLLFDEAITMTTVVGTALTALGVSFVVRSAKPPAAA
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccgtgttcgtgctgatctggagcaccggcttcatcgtcgccaaatacggcttg
ccgtatgcgccgccgctgaccttcctggcgatccgttatttcctctccattgcctgcttt
ctgatctggatagcgctggcgcgcgcgtcgtggccgcgggagggccggcaatggctgcac
ctggccgtcaccggcgtgctgatgcaggcaggttacctgggcggtgtctgggtcgcggtg
aaggctggcatgggttcgggcctgacggcgctgatcgtcggcttgcagccggtgctgacg
gcgctgtgggtgtcatggatggcgtcgggtgacacccgccagcagggctccacagttacg
tcccggcaatggatggggctggcgctgggcctgggcggcttgctgctggtggtgtcacac
aaattggggggcggacatgaggtgacggcattgacgctgaccgccacgctgtttgcgctg
ttcagcatcaccgtcggtacgctgtatcaaaagcgctttgtcaaacctgccgatgtgcgc
tgtgccggtgcggtccagatgggcgcggccctgctcgtgaccttgccgctggtttttttt
gaaaccggggcgattgtctggaaccaccagtttgtgggagccatggcctggtcggtgctg
gtgcttacgctgggcggcagctcgctgctgtatttgctgatccagcgcggcgcggccacg
tcggtgaccagcctgctttacctggtgccgccgacgacggccctgatggcctggttgctg
tttgatgaggccatcaccatgactaccgtggtgggtacggcgctcaccgcgctgggcgtg
agcttcgtggtgaggtccgcgaagcctccggcggcggcgtag

DBGET integrated database retrieval system