KEGG   Polaromonas sp. JS666: Bpro_3070Help
Entry
Bpro_3070         CDS       T00343                                 

Definition
(GenBank) CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00564  Glycerophospholipid metabolism
pol01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    Bpro_3070
Enzymes [BR:pol01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     Bpro_3070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf
Motif
Other DBs
NCBI-ProteinID: ABE44984
UniProt: Q128Q8
Position
complement(3235976..3236542)
Genome map
AA seq 188 aa AA seqDB search
MFLTIPTLMTWTRIVAIPLIVGVFYLNIAPAERNLIATVMFIVFAATDWLDGFLARRLNQ
TSSFGAFLDPVADKFLVCASLLVLVHLQRADVFVALIIIGREIAISALREWMALIGATKS
VAVHMLGKVKTTVQMIAIPFLLFDGMLLGMINTHVWGTWLIWISAILTVWSMIYYLQKAI
PEIRARAK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgtttctgaccatcccgacgctgatgacctggacccgcattgttgcgattccactgatc
gtgggcgttttctacctgaacatcgcccccgccgagcgcaacctgatcgccaccgtgatg
ttcattgtgttcgccgccactgactggctggacggctttttggcgcgtcggctgaaccag
acttcctccttcggtgcattcctggatccggtcgctgacaagttcctggtgtgtgcttcg
ctgctggtgctggtgcatctgcagcgtgcggatgtgtttgtggcgctcatcatcattggc
cgggagattgccatttcggcgctgcgcgaatggatggcgctgataggtgccaccaagagt
gttgccgtgcacatgctgggcaaggtcaagaccaccgtgcagatgattgccattcccttc
ctgctgtttgacggcatgctgctgggaatgatcaacacccatgtctggggcacctggctg
atctggatctcggccatcctgaccgtctggtccatgatttactacctgcaaaaagccata
ccggaaatccgggcgcgggccaaataa

DBGET integrated database retrieval system