KEGG   Polaromonas sp. JS666: Bpro_3073Help
Entry
Bpro_3073         CDS       T00343                                 

Definition
(GenBank) conserved hypothetical protein
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EarP
Motif
Other DBs
NCBI-ProteinID: ABE44987
UniProt: Q128Q5
Position
3240676..3241803
Genome map
AA seq 375 aa AA seqDB search
MADVRFLDIFCKVIDNFGDIGVCWRLAADLASRGHQVRLWVDDASALDWMAPARCKGVRV
LPWGEPLDLAAAGLDQQPSDVMIEAFGCEIAPEFIAACVRLEKAGGKKPVWINLEYLSAE
PYVERCHAMPSPVQGGPAAGWIKWFFYPGFTPSTGGLLCEADLAERQARFDRAAWLASQS
IPWRGEKLVSLYCYEPSALPGLLAHFAAHGLEGQPVRLLVAAGRAGNAVKAALSHENWPL
PLANGHKLLSISHLKLLPQAQFDHLLWACDLNFVRGEDSVVRALWAGKPFVWQIYPQHDD
AHQAKLHAFLDMLDAPPSLRAFHAHWNADEIELAGGASPAPDLPAWQITTLAARSRLLAQ
QDLSTRLLEFVAKNR
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atggctgacgtgcgttttttggacatcttttgcaaggtcatcgacaacttcggggacatt
ggcgtgtgctggcgcctggccgccgacctggcctcgcgcggccatcaggtgcggctatgg
gtcgatgacgcgtcggcactggactggatggcccccgcccgttgcaaaggcgttcgcgtg
ctgccctggggcgaaccgctggacctggccgcagccggacttgaccagcagccatccgac
gtgatgattgaagccttcggctgcgaaattgcacctgaattcatcgctgcctgtgtccgg
cttgaaaaggcgggcggcaaaaaacccgtctggatcaacctcgagtacctgtccgccgag
ccctatgtggagcgctgccacgccatgccgtcgcccgtgcagggcggaccggccgccggc
tggatcaagtggtttttttaccccggcttcaccccttcgacgggcggcctgctgtgcgaa
gccgacctggccgagcgccaggcccggtttgaccgcgccgcctggctggcctcccagtcc
atcccatggcgcggcgaaaagctggtttcgctgtattgctacgagccgtccgcgctccca
gggctgctcgcgcattttgcggcgcatggcctcgagggccagccggtgcgcctgctggta
gcggctggacgggcggggaatgccgtgaaagccgctttgagtcatgaaaattggcccctg
cccttggcaaacggtcacaaattgttgtcaatttcacacctgaagctgctgccgcaagcg
cagttcgaccacctgctgtgggcctgcgacctgaattttgtgcgcggtgaagactccgtg
gtgcgcgccctctgggccggcaaacctttcgtctggcagatctacccgcagcacgatgac
gcacaccaggccaagctgcacgcctttctcgacatgctggatgcccctccttcattgcgg
gcctttcatgcgcactggaatgcggacgaaatcgaactggccggcggtgccagcccggcg
ccggacttgccggcatggcaaataaccacactggcagcccggtcccgcctgctggcgcag
caggacctgagtacccgcctgctcgaatttgtggcaaaaaaccgttaa

DBGET integrated database retrieval system