KEGG   Polaromonas sp. JS666: Bpro_3082Help
Entry
Bpro_3082         CDS       T00343                                 

Definition
(GenBank) amino acid/amide ABC transporter ATP-binding protein 2, HAAT family
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase AAA_29 SMC_N AAA_30 AAA_27 AAA_23 MMR_HSR1 AAA_22 IstB_IS21 AAA_16 AAA_33 NACHT Arf
Motif
Other DBs
NCBI-ProteinID: ABE44996
UniProt: Q128P6
Position
complement(3250400..3251077)
Genome map
AA seq 225 aa AA seqDB search
MPDMRMNVQMDVPLDVEGLNAFYGPAQALFGISLQVRQREFVVLQGLNGAGKSTLLKALM
GLEVRTEGRISYQTETGRADIGQWPTHRRARAGLGYVPEDRRLFTGLTVRENLAVAAGRD
VAAHEARVLDLFPVLKTMLKRPAAQMSGGEQQMLAIARTLMTGPRLLLLDEPCEGIAPVL
VESIRDALLALRAGGMPMLVVEQNQLLAASADRLVRLVAGKVRGS
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgcctgatatgcgcatgaacgtgcaaatggacgtgcccctggacgtggaggggctgaat
gccttttatggcccggcccaggcgcttttcggcatttccctgcaggtgcggcagcgggag
ttcgtcgtgctgcagggactgaatggcgctggaaaatcgacgctgctgaaagccctgatg
ggtctggaggtgcgcaccgagggccgcatcagttaccagacggaaacgggccgcgccgac
atcggtcaatggccgacgcaccggcgcgcacgtgccgggctgggctatgtgcccgaagac
cggcggcttttcaccggcctgacggttcgcgagaacctggccgtggcggcaggccgggac
gttgcggcgcacgaggccagggtgctggatttgttcccggtgctcaagaccatgctgaaa
cggcccgctgcccagatgagcggcggcgagcagcagatgctggccattgcccgcacgctg
atgaccggcccgcgcctgctgctgctcgatgagccttgcgaaggcattgcaccggtgctg
gtcgagtccatccgcgatgccttgctggccctcagggcgggcggcatgcccatgctggtg
gtggagcaaaaccagctgctggcagccagtgctgaccggctggtccggctggttgcgggt
aaagtcaggggttcgtga

DBGET integrated database retrieval system