KEGG   Polaromonas sp. JS666: Bpro_3086Help
Entry
Bpro_3086         CDS       T00343                                 

Definition
(GenBank) thioesterase superfamily
  KO
K07107  acyl-CoA thioester hydrolase [EC:3.1.2.-]
Organism
pol  Polaromonas sp. JS666
Brite
KEGG Orthology (KO) [BR:pol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bpro_3086
Enzymes [BR:pol01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Bpro_3086
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 4HBT 4HBT_2 Acyl-ACP_TE
Motif
Other DBs
NCBI-ProteinID: ABE45000
UniProt: Q128P2
Position
complement(3254578..3255021)
Genome map
AA seq 147 aa AA seqDB search
MTSPMRPQAEPRSAYKAFRDIGTRWSDNDLYGHVNNVVYYSWFDTAVNGLLIERGALDIH
AGSVIGLVVETQCNYFAPLAFPEPVVAGIRVARVGASSARYEVALFPQDDAQACAAKGHF
IHVYVDRATRRPVPLPPQLLCVLETLK
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgacctccccgatgcgcccccaggcagagccccgcagtgcctacaaagcttttcgcgac
atcggcacgcgctggtccgacaacgatctgtatggccacgtcaacaacgtcgtttactac
agctggtttgacacggccgtcaacggtttgctgattgaacgcggtgcccttgacattcac
gcgggcagcgtgattggcctggtggtcgagacccagtgcaattacttcgcccctctcgcg
tttcccgagccggtggtggcgggcatccgggtggcccgcgtgggcgcgtccagtgcgcgc
tacgaggtggcgctgttcccgcaggatgatgcgcaggcgtgtgcggccaaaggccatttc
atccatgtgtatgtcgaccgcgccacgcgccgcccggtgcccttgccccctcaattactt
tgcgtactggagaccctcaagtga

DBGET integrated database retrieval system