KEGG   Polaromonas sp. JS666: Bpro_3091Help
Entry
Bpro_3091         CDS       T00343                                 

Definition
(GenBank) Patatin
  KO
K07001  NTE family protein
Organism
pol  Polaromonas sp. JS666
Brite
KEGG Orthology (KO) [BR:pol00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99996 General function prediction only
    Bpro_3091
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Patatin SAT Hydrolase_4
Motif
Other DBs
NCBI-ProteinID: ABE45005
UniProt: Q128N7
Position
complement(3258709..3259605)
Genome map
AA seq 298 aa AA seqDB search
MALAWALVLLAGCAAPPAPPVRSAPSTPTAEAVPKKPLKIGLALGGGAARGFAHVGVIAV
LEEAGLKPHYVVGTSAGSLVAALYASGRTSAQLQQTALNMQEVAITDWMLPIVGRGMFRG
EALARHVNELLAGRLIEDMPVPLGIVATDLNSGQAVLFQRGDTGTAVRASSAVPAVFVPV
RINGREYVDGGLVSPVPVRFARQMGADLVIAVDISSPPEANPAGDTLQILLQTFAIMGKS
INQYELKDADVVVRPSLAGLKSADFSARQRAIDLGRAAMLAALPALRAKLDAGAVPAH
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggcttgggccttggtgttgctggcggggtgcgctgcgccacccgctccaccg
gtgcgatccgccccatccacgccgacggccgaggccgtcccgaaaaagcctttgaaaatc
ggcctggcgctgggtggcggtgcggcgcggggctttgcccatgtgggcgtgattgcggtg
cttgaagaggccgggctcaagcctcattatgtggtcggcacctcggctggcagcctggtc
gccgcactttatgccagcggtagaaccagtgcccaactgcagcagaccgccttgaacatg
caggaggtcgccatcaccgactggatgctgccgattgtgggccggggcatgtttcgcggc
gaggccctggcacggcatgtcaatgaattgctggcgggccgcctgattgaagacatgccc
gttccgctgggcattgtggctaccgacctcaacagcggtcaggccgtgctgttccagcgc
ggcgacaccggcacggcggtgcgggcatcgagcgctgttccggcagtcttcgtgccggtc
aggatcaatggccgggagtatgtcgatggcggcctggtctcgccggtgccggtgcgtttt
gcgcggcaaatgggcgccgacctggtgattgcggtcgatatctccagcccgccggaggcc
aacccggccggcgatacgctgcagatactgctgcagacctttgccatcatgggcaaaagc
atcaaccagtatgaactgaaggatgccgatgtggtggtgcggccgtccctggccggcctg
aagagcgccgacttctcggcccggcaacgcgctatcgatttgggtcgggccgccatgctc
gcggcgctgcccgcgctgcgggccaaactggacgccggggcggtgccggcgcattga

DBGET integrated database retrieval system