KEGG   Polaromonas sp. JS666: Bpro_3092Help
Entry
Bpro_3092         CDS       T00343                                 

Definition
(GenBank) extracellular solute-binding protein, family 1
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
pol  Polaromonas sp. JS666
Pathway
pol02010  ABC transporters
Module
pol_M00190  Iron(III) transport system
Brite
KEGG Orthology (KO) [BR:pol00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Bpro_3092
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pol02000]
    Bpro_3092
Transporters [BR:pol02000]
 ABC Transporters, Prokaryotic Type
  Mineral and organic ion transporters
   Iron(III) transporter [MD:M00190] [OT]
    Bpro_3092
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SBP_bac_8 SBP_bac_6 SBP_bac_1 SBP_bac_11
Motif
Other DBs
NCBI-ProteinID: ABE45006
UniProt: Q128N6
Position
3259747..3260805
Genome map
AA seq 352 aa AA seqDB search
MFKKAPSLACLALATAAFFGAVGNVNAQEQVVNLYSARHYQTDEALYTNFTKATGIKVNR
VDADDAGILARLKAEGTASPADVILLVDAARLWKGDVEGLFKPIKSAALEAAIPAKLRAR
ETAEGTTWFGFSTRARVVVYDKLKVKKADVDTYEELADPKNKGLLCTRSGSHPYNLSLFG
AVTEHLGEAKAEAWLKGLVANMARDPKGGDTDQIKAVASGECGIALTNTYYLARIMRSST
PEDKTVADRVGVVFPNQDSWGTHVNIAGAAVAKNAKNTANAIKFMEYMASAEAQNYFANG
NNEWPAVSSVKVSNPALQAMTGGSFKSETIPISAVGGNQLKVQQMLDRVGYK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaaaaagctccttcactggcctgccttgcgctggccaccgcagccttctttggc
gccgtgggcaacgtcaacgcccaggagcaggtcgtcaacctgtattctgcacgccactac
cagaccgacgaagcgctgtacaccaacttcaccaaggctaccggcatcaaggtcaaccgt
gtcgatgccgatgatgccggcattctggcgcgcctgaaagccgagggtacggcctcgcct
gccgacgtgattttgctggtcgatgccgcccgcttgtggaaaggcgacgtggaaggcctg
ttcaagcccatcaagtcggccgctctggaagccgccattccggccaagctgcgcgcccgg
gaaaccgccgaaggcaccacgtggttcggcttttccacccgggcccgcgtggtggtgtat
gacaagctgaaagtcaagaaagccgacgtggacacctacgaagagctggccgatccgaaa
aacaagggcctgctgtgcacccgctcgggctcgcacccctacaacctctcgctgtttggc
gccgtgaccgagcacctcggcgaggccaaagcggaggcctggctcaagggactggtggcc
aacatggcacgcgacccgaagggcggcgacacggatcagatcaaggcagtggccagcggc
gagtgcggcatcgcactgaccaacacctactacctggcgcgcatcatgcgctccagtacg
cctgaagacaaaacggtagccgaccgcgtcggcgtggtgttccccaaccaggacagctgg
ggcacgcatgtgaacattgcgggtgcagccgttgccaaaaatgccaagaataccgccaac
gccatcaagttcatggagtacatggccagcgcggaggcacaaaactactttgccaacggc
aacaacgaatggcctgccgtgtccagcgtgaaagtcagcaaccccgcgctgcaagccatg
acgggcggcagcttcaagtcggaaaccattcccatcagcgccgtgggcggcaaccagctg
aaagtacagcagatgcttgatcgcgtcggttataagtaa

DBGET integrated database retrieval system