KEGG   Polaromonas sp. JS666: Bpro_3093Help
Entry
Bpro_3093         CDS       T00343                                 

Definition
(GenBank) short-chain dehydrogenase/reductase SDR
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short adh_short_C2 KR DUF1955 Sacchrp_dh_NADP TIR-like Shikimate_DH Epimerase DUF1521
Motif
Other DBs
NCBI-ProteinID: ABE45007
UniProt: Q128N5
Position
3261002..3261781
Genome map
AA seq 259 aa AA seqDB search
MDIAGKVFIVTGGASGLGEGTARMLVANGAKVVIADMQADKGEAIVSELTKELGEGKAAF
VPCDVSQEADGQAVVAKAVSMGKLMGLVNCAGIAPAEKTVGKNGAHGLALFSKTITVNLI
GSFNMIRLAADAMCKNEPEATGERGVLISTASVAAYDGQIGQAAYSASKGGIVGMTLPIA
RDLARNGIRNMTIAPGIFGTPMLFSMPQEVQDSLAAGVPFPSRLGTPQDYAKLAKHIIEN
DMLNGEVIRLDGAIRLAPR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcaggcaaagtatttatcgtcaccggcggcgcatcaggtctgggtgaaggc
acggcacgcatgctggtcgccaacggcgccaaggtggtgattgccgacatgcaggccgac
aagggcgaagccatcgtctccgagttgaccaaagaactcggggaaggcaaagccgcgttt
gtgccctgcgacgtcagccaggaggccgacggccaggccgtggtggccaaggccgtgtcc
atgggcaagctgatgggcctggtcaattgcgccggcattgcgcccgccgaaaaaaccgta
ggcaaaaacggcgcgcacggcctggccctgttcagcaagaccatcaccgtcaacctgatc
ggcagcttcaacatgatccggctggcagccgacgccatgtgcaagaacgagccggaagcc
accggcgagcgcggtgtgctgatttccaccgcctcggtcgcggcctatgacgggcagatc
ggccaggccgcctacagcgcgtccaagggcggcatcgtcggcatgaccctgcccattgcc
cgcgacctggcacgcaacggcatccgaaacatgaccatcgcccccggcatcttcggcacg
cccatgctgtttagcatgccgcaggaagtgcaggactcgctggccgccggcgtgcccttc
ccttcgcgcctgggtacgccgcaagactatgccaagctggccaaacacatcatcgaaaac
gacatgctcaatggcgaggtgatccgcctcgacggcgcgattcggctggcgccacgctga

DBGET integrated database retrieval system