KEGG   Polaromonas sp. JS666: Bpro_3095Help
Entry
Bpro_3095         CDS       T00343                                 

Definition
(GenBank) ribonuclease BN, putative
Organism
pol  Polaromonas sp. JS666
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Virul_fac_BrkB DER1
Motif
Other DBs
NCBI-ProteinID: ABE45009
UniProt: Q128N3
Position
complement(3264038..3264946)
Genome map
AA seq 302 aa AA seqDB search
MPTTMMIGPQATYVLSHPGAFALRVLKGFRANQGLLLAGAVAYYALLSIVPLLILMAIAL
SHVIDQSALLEALGRYIGWLAPGQSEFIVGELANFLAHREVMGWLLLATMLFFSSLAFTV
LENAMSVVFLHRVVIRRRHFLVSAVLPYCYILCLGLGLLLVTLVSGSMQALGEKSVEFLG
YSWSLSGFSGVLLYLLGLAGEIFLLTSVYMVMPVGRLSLRHALIGGVTAALLWEVTRHAL
VWYFGTLSQVGLVYGSLTTAIVVLLSLEIAATLLLLGAQVISEYERIGTVLENAPAQPMR
MD
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgcccaccaccatgatgatcggaccgcaggccacttacgtactcagccatcccggcgcc
tttgcgttgcgggtactcaagggctttcgcgccaaccagggcctgctgctggccggggcc
gtggcttactacgccttgctgtcgattgttccgttgctgatcttgatggcgattgcactg
tcgcatgtgattgaccaatcggcactgctggaagcgctgggccgctacatcggctggctg
gcgccgggacagtccgaattcattgtcggagagctcgccaatttcctggcgcatcgtgaa
gtcatgggctggctgttgctggccaccatgctgtttttcagttcactggcttttaccgtg
cttgaaaatgcgatgtcggtggtgtttttgcaccgcgtggtcattcggcggcgccatttt
ctggtgtctgccgtgctgccctactgctacatcctgtgcctggggctaggcctgctactg
gtgacgctggtctcgggcagcatgcaggcgctgggcgaaaaaagcgtggagtttctgggc
tacagctggtcgctcagcggattctcgggtgtgttgctatacctgctcgggctggccggc
gagatttttctgctgacatcggtgtacatggtgatgccggtgggcaggctgtcgctgcgc
cacgcgttgattggcggggtcacggctgcgctgctttgggaggtgacgcgccatgccttg
gtctggtactttggcacgctgtcgcaggtgggcctggtgtatggctcactgaccaccgcc
atcgtggttttgctgagcctggaaatcgccgccacgctgctgttgctgggcgcgcaggtc
atttccgagtacgaacgcatcggcacagtcttggaaaacgccccggcccagcccatgcgg
atggactag

DBGET integrated database retrieval system