KEGG   Polaromonas sp. JS666: Bpro_3098Help
Entry
Bpro_3098         CDS       T00343                                 

Definition
(GenBank) mandelate racemase/muconate lactonizing enzyme
  KO
K22209  D(-)-tartrate dehydratase [EC:4.2.1.81]
Organism
pol  Polaromonas sp. JS666
Brite
KEGG Orthology (KO) [BR:pol00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Bpro_3098
Enzymes [BR:pol01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.81  D(-)-tartrate dehydratase
     Bpro_3098
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C MR_MLE_N
Motif
Other DBs
NCBI-ProteinID: ABE45012
UniProt: Q128N0
Position
complement(3269940..3271106)
Genome map
AA seq 388 aa AA seqDB search
MKIVEIREKTIPISSPIRNAYIDFSKMTLSLVAVITDVIRDGKPVVGYGFNSNGRYGQGK
LMRERFIPRVMEAAPESLIDASGNNFDPHKIWNTMFTNEKPGGHGERSVAIGTIDMAVWD
AVAKIEGKPLFQLLADRYGNGQPNRKIFVYAAGGYYYPGQDHNKLKDEMRSYIDRGYTVV
KKKIGGASLDEDLRRIDSIMEVLQDGQKLCVDANGRFDLDTAIAYAKALSQYDLFWYEEP
GDPLDFELQATLRNYYKNPMATGEDLFSMQDARNLIRYGGMRPDRDWLQFDCALSYGLVE
YLRTLDMLKEHGWSPSRCIPHGGHQMSLNIAAGLGLGGNESYPDLFQPFGGFPDGVMAEN
GHVTLPALPGIGFEGKADLYSEMRALSD
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtgaagatcgttgaaatccgtgaaaagaccatccccatcagctcgcctattcgcaacgct
tatatcgattttagcaagatgacgttgagcctcgtggccgtcatcaccgacgtgatccgc
gacggcaagccggttgtcggctacggattcaactcgaacgggcgctatgggcagggcaag
ctcatgcgtgagcgcttcattccccgtgtgatggaggcggcacctgaatcgctcatcgat
gcgagcggcaacaacttcgatccgcacaagatctggaacacgatgttcaccaacgagaaa
ccgggcggtcacggcgagcgctcggtggcgatcggcacgatcgacatggcagtgtgggat
gcggtcgctaagatcgaaggcaaaccgctgtttcaactgctcgccgaccgctacggcaac
ggccagcccaaccgcaagatattcgtctacgcggccggcggctactactacccaggccag
gaccacaacaagctgaaagacgagatgcgcagctacatcgatcggggctacaccgtggtc
aagaagaagatcggcggcgcgtcgctcgatgaagacttgcgccgcatcgactcgatcatg
gaagtgctgcaggacggccagaagctgtgcgtggacgccaacggccgcttcgacctggac
accgcgattgcctacgccaaggcactctcacagtatgacctgttctggtacgaagagccc
ggtgacccgctcgattttgagctccaagccacgctgcgcaactactacaagaacccgatg
gcaaccggcgaagacctgttctcgatgcaggacgcgcgcaacctgatccgctatggcggc
atgcgcccggaccgcgactggctgcaattcgactgcgcattgagctacggcctggtcgag
tacctgcgcacgctggacatgctcaaggagcatggctggtccccgagccgctgcattccg
cacggcggtcaccagatgtccctcaatattgcggcgggcctcgggctggggggcaacgag
tcctatccggacctgttccagccgtttggcggcttcccggacggtgtgatggcggagaac
ggccacgtgacgctgcccgccttgcccggcatcggattcgagggcaaggcggatctgtac
agcgaaatgcgcgcactgtccgactga

DBGET integrated database retrieval system