KEGG   Polaromonas sp. JS666: Bpro_3113Help
Entry
Bpro_3113         CDS       T00343                                 

Definition
(GenBank) Acetyl-CoA C-acyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00071  Fatty acid degradation
pol00072  Synthesis and degradation of ketone bodies
pol00280  Valine, leucine and isoleucine degradation
pol00310  Lysine degradation
pol00362  Benzoate degradation
pol00380  Tryptophan metabolism
pol00620  Pyruvate metabolism
pol00630  Glyoxylate and dicarboxylate metabolism
pol00640  Propanoate metabolism
pol00650  Butanoate metabolism
pol00900  Terpenoid backbone biosynthesis
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01200  Carbon metabolism
pol01212  Fatty acid metabolism
pol02020  Two-component system
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Bpro_3113
   00630 Glyoxylate and dicarboxylate metabolism
    Bpro_3113
   00640 Propanoate metabolism
    Bpro_3113
   00650 Butanoate metabolism
    Bpro_3113
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Bpro_3113
   00072 Synthesis and degradation of ketone bodies
    Bpro_3113
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Bpro_3113
   00310 Lysine degradation
    Bpro_3113
   00380 Tryptophan metabolism
    Bpro_3113
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Bpro_3113
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Bpro_3113
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Bpro_3113
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pol04147]
    Bpro_3113
Enzymes [BR:pol01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Bpro_3113
Exosome [BR:pol04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Bpro_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III UBA_3
Motif
Other DBs
NCBI-ProteinID: ABE45027
UniProt: Q128L5
Position
3286818..3288068
Genome map
AA seq 416 aa AA seqDB search
MATPGFFSHFDDIWMLDGVRTPMVDYCGALGHISPTDLGIKAARSALERSGVPAAHIGSV
IAGNMAPGDFDQFMLPRHIGLYAGVPLEVPALMAQRICGTGFELFRQAGEHIQSGACEAA
LVVGAESMTRNPIAAFDHRTGFKLGAPVGFKDYMWEALKDSAAGINMIQTAENLAKKYGV
TREQVDEFASQSFARAVAAQQSGFHAGEIVPVVSETFGLEGYASRSIKLQGKLTEVAQDT
HARISPAEVLAKLRPVYEGGVQTGGNSAALVDAAAAAIVASGSYAKAHDKKPLARVVAAA
VVGVPPEIMGIGPAPAIRLLLERTGMTLDQIGRFEINEAQGAQTLAVGRELELDLNRLNV
NGGAIALGHPLATTGVRLTITLARELRRAGLRWGIASACIGGGQGIALLLENPGAA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggccaccccaggctttttctcccactttgacgacatctggatgctggacggcgtgcgc
acgcccatggtcgattactgtggcgcactcggccacatttcgcccacggacctgggcatc
aaggccgcgcgctccgccctggaacgcagcggcgtgccagccgcgcatatcggctccgtc
attgccggcaacatggcgccgggcgactttgaccagttcatgctgccgcgccacattggc
ctgtatgcgggcgtaccgctggaggtgcctgccctgatggcgcagcgtatttgcggcacc
ggttttgagctgttccggcaggccggcgagcacatccagagcggcgcctgcgaggcggcc
ctggtggtgggcgccgagagcatgacgcgcaacccgattgccgcctttgaccaccgcacc
ggcttcaaactgggcgcgccggtcggtttcaaggactacatgtgggaggccttgaaagac
tcggcggcgggtatcaacatgatccagacggccgagaacctggccaaaaaatacggcgtc
acgcgcgagcaggtcgacgaatttgcctcgcaatcgtttgccagggccgtcgcagcgcag
caatccggcttccacgcgggcgagatcgtgccggtggtgtctgaaacattcgggcttgaa
ggctacgcatcgcgcagtatcaagctgcagggcaagctcaccgaagtggcgcaggacacc
cacgcccgcatttcacccgccgaggtgctggccaaactccgcccggtgtatgaaggcggc
gtccagaccggtggcaacagcgcggcgctggtcgatgcggctgcggcggccattgtggcc
tccggcagctatgccaaagcccatgacaaaaagccactcgcacgcgtggttgccgccgcc
gtggtgggcgtgccacccgagatcatgggcatcggcccggcaccagccattcgcctgctg
ctggagcgcaccggcatgacgctggaccagattggccgcttcgagatcaatgaagcccaa
ggcgcgcaaacattggccgtaggccgcgagctggaactggatttgaacaggctcaacgtc
aacggcggcgccatcgcactcggccatccgctcgccaccaccggcgtgcgcctgaccatc
acgctggcgcgcgaactcaggcgtgccggtctgcgctggggcattgcatcggcctgcatt
ggcggcggacagggcatcgccttgctgctggaaaacccgggcgcggcctga

DBGET integrated database retrieval system