KEGG   Polaromonas sp. JS666: Bpro_3630Help
Entry
Bpro_3630         CDS       T00343                                 

Definition
(GenBank) glycoside hydrolase, family 3-like protein
  KO
K01207  beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00520  Amino sugar and nucleotide sugar metabolism
pol01100  Metabolic pathways
pol01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:pol00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Bpro_3630
 Human Diseases
  Drug resistance
   01501 beta-Lactam resistance
    Bpro_3630
Enzymes [BR:pol01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Bpro_3630
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: ABE45534
UniProt: Q126K8
Position
complement(3832304..3833362)
Genome map
AA seq 352 aa AA seqDB search
MTQHAPLIIDIAGLSLTKADRRRLKHPLTGGIILFGRNWKDRQQLTDLCADIKRVRPDLL
ICVDHEGGRVQRFRTDGFTHLPPMRALGALWMKDQLAATNAATACGYVLGAELRACGVDF
SFTPVLDLDWGESGVIGDRAFGRDPRVVSLLAKSLMHGLLQSGMTNCGKHFPGHGFVKAD
SHTDIPVDKRSLKAILADDAAPYEWLNTTLTSVMPAHVIYPKVDARPAGFSEKWLTFILR
GQLGFGGAIFSDDLSMAGARLLDGKEVSYPQAAVAALNAGCDMVLLCNQSVGDGKPVDEL
LDGMAEALLKGQWEALESSEMRRLDLLPVTPAHEWDELMLHPAYMHAMGLIP
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgacccagcacgctcccctgatcatcgacattgcgggcctgtccctcaccaaggccgac
cgccggcgcctgaagcacccgctgaccgggggcatcatcctgttcggccgtaactggaaa
gaccgccagcagctcacggacctgtgcgccgacatcaaacgcgtccgccccgatttgttg
atttgcgtcgatcacgaaggcggccgtgtccagcgcttccggaccgacggtttcacccat
ctgccgcccatgcgtgcgctgggtgcgttgtggatgaaggaccagctggccgccaccaat
gcggccaccgcctgcggttatgtactgggtgccgagttgcgtgcctgcggcgtggacttc
agtttcacgccggtgctggatctcgattggggcgaaagcggtgtcatcggcgaccgcgcc
ttcggccgcgacccgcgcgtggtcagcctgctggccaaaagcttgatgcatggcctgctg
caaagcggcatgaccaactgcggcaaacattttcccggccatggtttcgtcaaggccgat
tcgcacactgacattccggtcgacaagcgcagcctcaaggccatcctcgccgacgatgcc
gcgccttatgaatggctcaacaccacgctgaccagcgtgatgccggcgcatgtgatttac
cccaaggtcgatgccaggccggcggggttttcggaaaaatggctgaccttcattttgcgc
ggccagctcggttttggcggcgcgattttcagcgacgacctgagcatggccggggcacgc
ctgctggacggcaaagaggttagctacccccaggccgcggtggccgcgctcaacgccggc
tgcgacatggtgctgctgtgcaaccagtccgtgggagacggcaagcccgtcgatgaattg
ctcgacggcatggccgaggcgctgctcaaaggccaatgggaggcgctggagtccagcgaa
atgcgcaggcttgatctgctgccagtgacgccagcccacgaatgggacgagctcatgttg
caccccgcctatatgcatgcgatgggcttgattccctga

DBGET integrated database retrieval system