KEGG   Polaromonas sp. JS666: Bpro_4203Help
Entry
Bpro_4203         CDS       T00343                                 

Definition
(GenBank) glycyl-tRNA synthetase alpha chain
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:pol00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Bpro_4203
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:pol01007]
    Bpro_4203
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:pol03016]
    Bpro_4203
Enzymes [BR:pol01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     Bpro_4203
Amino acid related enzymes [BR:pol01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   Bpro_4203
Transfer RNA biogenesis [BR:pol03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    Bpro_4203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e
Motif
Other DBs
NCBI-ProteinID: ABE46095
UniProt: Q124E7
Position
complement(4421716..4422621)
Genome map
AA seq 301 aa AA seqDB search
MLTFQQIILKLQSYWDAQGCALLQPYDMEVGAGTSHTATFLRALGPEPWKAAYVQPSRRP
KDGRYGENPNRLQHYYQYQVVLKPAPANILELYLGSLEALGFDLKKNDIRFVEDDWENPT
LGAWGLGWEVWLNGMEVTQFTYFQQVGGIDCKPITGEITYGLERLAMYLQGVDNVYNLTW
TDGLSYGDVYKQNEVEQSTYNFEHSDADFLFTAFTAHEKQAKHLIGVQLALPAYEQVLKA
AHSFNLLDARGAISVTERAAYIGRIRNLARAVAQSYYESRERLGFPMAPREWVEQMTKKA
A
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgctcactttccagcaaattatcctgaagctgcagtcctactgggatgcccagggctgc
gccctgttgcagccctatgacatggaagtcggtgccggtacgtcacacactgctacgttt
ttaagagcgctcggccctgagccctggaaggccgcctatgtacagccgagccgtcggccg
aaagacgggcgctacggcgagaaccccaaccgcctgcagcattactaccagtaccaggtg
gtgctcaagcccgcgccggccaacatcctggagctttacctcggctcgcttgaagccctc
ggttttgatttgaagaaaaacgacatccgctttgtcgaggacgactgggaaaaccccacg
ctcggcgcctggggcctgggctgggaagtctggctcaacggcatggaagtcacgcagttc
acctacttccagcaggtcggcggcatcgactgcaagcccatcaccggcgagatcacctac
ggactggaacgcctggccatgtacctgcagggtgtggacaacgtctacaacctgacgtgg
acggatggtttgagctatggcgatgtctacaagcaaaacgaggtggagcagtccacctac
aacttcgagcacagcgacgccgacttcctgttcaccgcctttacggcgcatgaaaagcag
gccaaacacctgattggcgtgcaactggccctgcccgcgtacgagcaggtgctcaaggcc
gcgcacagcttcaatctgctggacgcccgcggcgcgatttcggtgacggaacgagccgcc
tacatcggccgcatccgcaacctggcgcgtgccgtggcacaaagctactatgagagccgc
gaacggctcggcttcccgatggcgccccgcgagtgggtggaacagatgacgaagaaggcg
gcgtga

DBGET integrated database retrieval system