KEGG   Polaromonas sp. JS666: Bpro_4454Help
Entry
Bpro_4454         CDS       T00343                                 

Definition
(GenBank) L-threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pol  Polaromonas sp. JS666
Pathway
pol00260  Glycine, serine and threonine metabolism
pol01100  Metabolic pathways
pol01110  Biosynthesis of secondary metabolites
pol01120  Microbial metabolism in diverse environments
pol01130  Biosynthesis of antibiotics
pol01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pol00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Bpro_4454
Enzymes [BR:pol01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     Bpro_4454
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: ABE46341
UniProt: Q123F1
Position
complement(4707770..4708882)
Genome map
AA seq 370 aa AA seqDB search
MVVDLRSDTVTQPSAAMRAAMQAAPLGDDVFGDDPSVNALQEKIAGMLGFEAALFVPTGT
QSNLCAILSHCQRGDEYIVGQMAHCYRWEGGGAAVFGSVQPQPLNHQPDGTLAVAEIEAA
IKPDDPHFAITRLLALENTLGGKLLPFGYVQQATQLAQAKGLSRHLDGARLFNAAVAQAA
LSVRAELVEAAAGTSTGSVRTEVTRDSAVAEARRIAQCFDSVSVCFSKGLGAPVGSALCG
SREFIARARRVRKMAGGAMRQSGMLAAAASYALDHHIERLAQDHALARQLADGLAGIEGL
HVEAPETNILFVDLSGAARDKSAALLKYLADHGIQATGLYRLRFVTHLDVDAAGVDRAVA
AIRQFFHLKG
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atggttgttgatctgcgcagcgacaccgtcacccagcccagcgccgcgatgcgtgcagcc
atgcaggccgcgccgctgggcgacgacgtgtttggcgacgaccccagcgtcaacgcgctg
caggagaaaattgccggcatgctgggctttgaggccgcgctgtttgtacccaccggcacg
cagagcaacctctgcgcgatcttgagccactgccagcgcggcgacgaatacatcgtcggc
cagatggcgcactgctaccgctgggaaggcggcggtgcggcggtgtttggcagcgtgcag
ccgcagccgctgaaccaccagcccgacggcacgctggcggtcgccgagatcgaagctgcc
atcaagcccgatgacccgcattttgcgatcacccgactgctggcactggaaaacacgctg
ggcggcaagctgttgccgtttggctatgtgcagcaggccacgcagttggcgcaggccaaa
ggcctgagccgccatctggacggcgcgcggctgttcaacgccgccgtggcgcaagccgca
ctgtccgttcgggctgagcttgtcgaagccgctgcaggcacttcgacaggctcagtgcga
acggaagttacccgcgacagtgccgtcgccgaagccaggcgcatcgcccagtgtttcgac
agcgtgtcggtgtgtttcagcaaggggctgggcgcgcccgtgggctccgcgctgtgcggc
tcgcgcgagttcattgcgcgggcgcgccgcgtccgcaagatggccggcggcgcgatgcgc
cagtccggcatgctggcggccgccgccagctacgcgctggaccatcacattgaacgcctg
gcgcaggaccatgcgctggcccggcaactggccgacggtctggcggggattgagggcttg
cacgtggaagcgcccgagaccaatatcctctttgtcgacctgagcggcgcggcccgcgac
aaatctgccgccctgctcaagtacctggccgatcacggcattcaggccacgggcctgtat
cgcctgcgttttgtcacgcacctcgatgtggacgctgccggtgtggaccgcgccgtggcc
gcgatccggcagttcttccatctcaaaggataa

DBGET integrated database retrieval system