KEGG   Polaromonas sp. JS666: Bpro_4467Help
Entry
Bpro_4467         CDS       T00343                                 

Definition
(GenBank) ApaG
  KO
K06195  ApaG protein
Organism
pol  Polaromonas sp. JS666
Brite
KEGG Orthology (KO) [BR:pol00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    Bpro_4467
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 YjzC DUF11
Motif
Other DBs
NCBI-ProteinID: ABE46354
UniProt: Q123D8
Position
4722582..4722977
Genome map
AA seq 131 aa AA seqDB search
MSKYHFSCEVIPQYQPGQSAPEDGIYGFSYTVTLTNTGDVAAQLISRHWLISDANGHTEE
VKGLGVVGHQPLLKPGESFQYTSGSRLRTPSGTMHGSYFCVAEDGTRFEVAIPMFVLEAH
QGGNPAGRVLH
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaataccatttttcctgcgaagtcataccccagtaccagcctggccagtcagcg
cccgaggacgggatttacgggttttcctacaccgtcacgctcaccaataccggcgatgtg
gccgcccaactgatttcccgccactggctcatcagtgacgccaacggccacaccgaagaa
gtcaagggactgggcgtcgtggggcatcagccgctgctcaagccgggcgaatccttccag
tacaccagcggctcgcgcctgcgcacgcccagcggcaccatgcacggcagttatttttgt
gtggcggaagacggcacgcggtttgaggtcgccatccccatgtttgtgctggaggcacac
caggggggcaatccggccggccgcgtcctgcattga

DBGET integrated database retrieval system