KEGG   Polaromonas sp. JS666: Bpro_4821Help
Entry
Bpro_4821         CDS       T00343                                 

Definition
(GenBank) Cytochrome-c peroxidase
  KO
K00428  cytochrome c peroxidase [EC:1.11.1.5]
Organism
pol  Polaromonas sp. JS666
Brite
Enzymes [BR:pol01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Bpro_4821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CCP_MauG Cytochrom_C PSCyt3 Cytochrome_CBB3
Motif
Other DBs
NCBI-ProteinID: ABE46698
UniProt: Q121U4
Position
5103114..5104100
Genome map
AA seq 328 aa AA seqDB search
MSAVRTTMQTTTSSMLKLVIVMVVWASQPATAALLDEPIQPIPPTLKQDPARADIGRLLF
RDARLSGNGRVSCASCHDLGKGGVDGRARSMGLNDGLTDINTPTVLNAALNFKQFWNGRA
DSLEAQIDHVMQSPVEMGSKWEEVVQKVSQDAGYKSAFAAAYKDGVTKANIQNAIATFER
TLITPNSRFDKFLRGDANAISATEKAGYAKFKQYGCVACHQGVNVGGNMFQKFGVMGNYF
EKRGNPTQADLGRYLVTKVESDKYVFKVPSLRNVALTAPYFHDASAKTLEDAVDIMFRYQ
LGRVASSEDKESIVRFLGTLTGELGTKP
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcggtccgtacaaccatgcaaacaacgacatcgagcatgttgaagctcgtgatc
gtcatggtcgtctgggcatcccaacccgccactgcggccttgctcgatgagccgatccag
ccgattccgccgaccctgaagcaggatccggctcgcgccgacatcgggcgcctgctgttt
cgcgatgcgcgcctgtccggcaatggccgtgtgtcttgcgccagctgccacgatctgggc
aagggcggtgtcgatggtcgcgcgcgttccatgggactgaatgatgggctgaccgacatc
aacaccccgaccgtgctcaatgccgcgctcaatttcaagcagttctggaacggccgtgcc
gactcgctggaagcacaaattgatcacgtcatgcagagcccggtggagatgggttcaaaa
tgggaagaagtcgtccagaaagtgtcgcaggacgccgggtacaagagcgcatttgcggct
gcctacaaagacggggtcaccaaagcgaatatccagaacgccatcgcgactttcgagcga
accctgatcacgccaaattcgcgctttgacaaatttctgcgtggtgacgccaacgccatt
tccgccaccgagaaagccggatacgcaaagttcaagcagtatggatgcgtcgcctgccac
cagggcgtgaatgtgggcggcaacatgtttcagaagtttggcgtcatgggcaactacttc
gagaagcgcggcaatccgacgcaggccgatcttggccgctatctcgtcaccaaggtggaa
agcgacaaatatgtcttcaaggtgcccagcctgcgcaacgtcgcgctgaccgcgccctac
tttcacgatgcctcggcgaagacgctggaagatgccgttgacatcatgttcaggtaccag
ctcggccgtgtcgcctccagcgaggacaaggaatcgatcgtcaggtttctgggcacgctg
accggtgaactgggcacaaagccgtga

DBGET integrated database retrieval system