KEGG   Polaromonas sp. JS666: Bpro_5237
Entry
Bpro_5237         CDS       T00343                                 
Name
(GenBank) conjugation TrbI-like protein
  KO
K20533  type IV secretion system protein TrbI
Organism
pol  Polaromonas sp. JS666
Pathway
pol02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:pol00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    Bpro_5237
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:pol02044]
    Bpro_5237
Secretion system [BR:pol02044]
 Type IV secretion system
  Trb secretion system protein
   Bpro_5237
SSDB
Motif
Pfam: TrbI
Other DBs
NCBI-ProteinID: ABE47098
UniProt: Q120E4
Position
1:346138..347589
AA seq 483 aa
MSISDKSIIDPEPNNPGIPIKKSTLGVIAALVVAVAFVSALLLDAGAPAPTSVAHAESKS
TDPTQDSGSKATIDEELKKAKQAADEEDRKKGLVKPSQTAQTVAQGPQQTGVQPLVTAAG
AQHNSQSPLPPGVRRDNQDGAFYDKALSKGTPTAGTHGGAVTGNGRGGEDFEIEAQVRGA
KALAFDESQASSAIAQGAQGSIVQTGLPASGVNVAQRSLAALPDLVSAGITQAPSATVQT
SMDRMLGNLRGAQGGISARAQGGGSGNAAWVNDYASGTGQRSSETIKSYPTSSAYTLHQG
KVIPAVLGRQINSDLPGEITAYVVTNVYDSLGNGALLIPKGSVLAGRYNSEVKPGQERVL
FAFNRLIMPNGQSFDLPGAQGSDLAGASGISGDVNNHFFKMFSASFFTAWLADRVTPQTT
TSGVGGSTTSVSPAGQVLVDVSKAILDRNRTIPPTITVDQGTRINVEVKKDMEFSGPYSW
SKK
NT seq 1452 nt   +upstreamnt  +downstreamnt
atgagcatttcggacaagtcaattattgacccggagccgaacaatcctggtattcccatc
aagaaatcgactttgggtgtaatcgctgcattggtcgtggctgttgcgttcgtcagcgcg
ttgctgctcgacgcgggagcgcctgcaccgacatcggtagcccacgcagaatcgaagtcg
actgatcctacccaggactccggttcgaaagctaccattgacgaggagctgaagaaggcc
aagcaagctgctgatgaggaagatcgcaaaaagggtctagtgaagccttctcaaactgca
cagacagttgcacaagggcctcaacagacgggtgttcagccgttagttacagccgccggc
gcgcagcataactcgcaaagtcctctgcctcctggagttcgtcgcgacaaccaggatgga
gcgttctacgacaaggccctgtctaaggggacccccactgcgggaacccatggcggcgcc
gtgaccggcaacggccgcggtggggaagactttgagattgaggctcaagttcgtggtgca
aaagcacttgcctttgatgagtcgcaggcatcttcagcgattgcccagggcgctcaaggg
tcaatagtgcagacgggcctaccggcgtcaggagtaaatgtagcccagcgatcgctcgcc
gcattgccagatctggtctccgcaggaataacccaggccccaagcgcaacggttcaaacc
tccatggaccgtatgcttggaaacctgcgcggtgctcaaggtggtatttcagcccgggcc
caaggcggcggtagtggaaatgcagcgtgggtaaatgactatgcatccggaactggtcaa
cgtagctcggaaacgatcaagtcctaccctaccagctcggcttacacactccatcaaggc
aaggtcattccagctgtacttgggcggcagatcaactcggatttgccgggtgagattacg
gcctatgtggtgaccaacgtctatgacagccttggtaatggagccctgctgattcccaag
ggttcagtactggctggtcgctacaactccgaagtaaagccaggccaggagcgtgtcctg
tttgcgttcaaccgcttgatcatgccgaatgggcagagttttgacttgccaggtgctcag
ggctctgatcttgctggagcttcgggtatctccggcgatgtcaacaaccattttttcaag
atgttcagtgcgagcttctttacggcgtggttggccgatcgcgtcacgccacagacaacg
accagcggtgtgggtggatcgactacctcagtgtcaccggcggggcaggtccttgtcgac
gtgagcaaagccatcctcgacaggaaccgcacaatcccgccgaccatcactgtcgatcag
ggtacgcgcatcaatgtggaagtcaaaaaagacatggaattctcaggtccgtatagctgg
agcaagaaatga

DBGET integrated database retrieval system