KEGG   Polaribacter sp. BM10: BXQ17_04830Help
Entry
BXQ17_04830       CDS       T04746                                 

Definition
(GenBank) threonine aldolase
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
pola  Polaribacter sp. BM10
Pathway
pola00260  Glycine, serine and threonine metabolism
pola01100  Metabolic pathways
pola01110  Biosynthesis of secondary metabolites
pola01120  Microbial metabolism in diverse environments
pola01130  Biosynthesis of antibiotics
pola01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pola00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BXQ17_04830
Enzymes [BR:pola01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     BXQ17_04830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Cys_Met_Meta_PP Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AQS93450
UniProt: A0A1U9L6A2
Position
complement(1083937..1084956)
Genome map
AA seq 339 aa AA seqDB search
MIIDLISDTVTRPTKEMLASMMSAKVGDDVFNMDPTVNKLQEKATKMFGMEAALFFPSGT
MANQTAIKLHTQPGDQLICDKYAHVYNYEGGGVAFNSGVTCKLIDGNRGMFTAEQLEEVA
STTPQIYLPYNKLVCIENTTNKGGGACWDFSELEKIKKVTKGNNLKFHLDGARLFNALVA
KNETPKQYGQLFDTISICLSKGLGAPIGSILLGSKKDIEKALRLRKLLGGGMRQVGFLAA
AGIYALDNHVNRLAEDHQKAKEIGTVLKSCSYITKVETIETNIVIFYVDKEIGADNFIAK
MKDKNILLTPMGEGKIRIVTHLDYTNEMHEILLRELKNF
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
atgattatagatttaatttcggatacagttacaagaccaacaaaagaaatgttggcttcg
atgatgagtgctaaagttggtgatgatgtttttaacatggatcctacggtaaataaatta
caagaaaaagctactaaaatgtttggtatggaagctgctttattttttccttctggtacg
atggcaaatcaaacagctataaaattacatacgcaaccaggtgatcaattaatctgcgat
aaatatgcacatgtttataattatgaaggtggtggtgttgcttttaattctggtgtaact
tgtaaattgattgatggtaatagaggtatgtttactgcagaacagttagaagaagttgct
agtacaacacctcaaatatatttaccttataataaattagtttgtatagaaaatacaaca
aacaaaggtggtggagcatgttgggatttttccgaattagaaaaaataaaaaaagtaact
aaaggtaataatttaaagtttcatttagacggagcacgtttgtttaatgctttagtcgct
aaaaatgaaactccaaaacaatacggacaattgtttgatactatttctatctgtttatca
aaaggtttaggtgccccaattggatcaatcttattaggttccaaaaaagatatagaaaaa
gccttaaggttaagaaaattattgggtggtggtatgagacaagttggttttttggcagct
gccggaatttatgcattagacaatcatgtaaatagattagcagaagatcatcaaaaagca
aaagaaataggaactgttttaaaatcttgctcttacattacaaaagtagaaactatagaa
acaaatattgttattttttatgttgataaagaaataggtgcagacaactttatagctaaa
atgaaagataaaaatattttattaactcctatgggagaaggtaaaataagaattgtaact
catttagattataccaatgagatgcatgaaattctattaagagaattaaaaaatttttag

DBGET integrated database retrieval system