KEGG   Polaribacter sp. BM10: BXQ17_06820Help
Entry
BXQ17_06820       CDS       T04746                                 

Definition
(GenBank) formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
pola  Polaribacter sp. BM10
Pathway
pola00670  One carbon pool by folate
pola01100  Metabolic pathways
pola01120  Microbial metabolism in diverse environments
pola01200  Carbon metabolism
Module
pola_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:pola00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    BXQ17_06820
Enzymes [BR:pola01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     BXQ17_06820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS DUF2913
Motif
Other DBs
NCBI-ProteinID: AQS93785
UniProt: A0A1U9L6R4
Position
complement(1509815..1511491)
Genome map
AA seq 558 aa AA seqDB search
MKHQTDIAIAQAKKLLHIKEIAVKINVKEDDLEMYGKYKAKLPLHLIDETKVKENNLVLV
TALTPTPAGEGKTTVSIGLTEGLNKIGKQATVVLREPSLGPVFGIKGGAAGGGYSQVVPM
EDINLHFTGDFNAIEKANNLLSALIDNNIQSKTNNLNIDPRTILWKRVIDMNDRALREVT
IGLGGTANGIPRQDGFNITPASEVMAILCMASDLENLKERLGNIFIGFTFDKKPVFARDL
KAENAMAILLKDAIKPNLVQTLEENPAIIHGGPFANIAQGTNTIIATKMGLSLSNYVVTE
AGFGADLGAEKFLNIKSQFADLNPKCVVLVATIRALRHHGGALKDAYDTADLAKVKKGFA
NLEKHIENIRKFNIEPVVAINSFISDSEEEVNFLIESCANLGVKAVLSKGWANGGEGTSD
LAKAVVEVVETKATQYKPLYNWQSPVKDKIEIIAKEIYGADKVVYDNKALLNLKRIDRLG
FNDFAVCMAKTQKSFSDNDKLIGRPKNFVITVREIEIAAGAQFVIPILGKMMRMPGLPSK
PASENMFIDKNGVISGLS
NT seq 1677 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaccaaacagatattgcaattgctcaagcaaaaaagttgttgcatataaaagaa
attgcagtaaaaataaatgtgaaagaagacgatttagaaatgtatggtaaatacaaagct
aaattgccattacatttaatagatgaaaccaaggtgaaagaaaataatttggttctggta
actgcattaactccaactcctgccggagaaggtaaaacaacagtttccataggattaact
gaaggattaaataagattgggaaacaagcgacagtggttttgagagaaccttctttaggg
cctgttttcggaattaaaggaggtgcagctggcggtggatattctcaagttgtgccaatg
gaagacatcaatctgcattttacaggagattttaatgcaatcgaaaaagccaataattta
ctatctgctttgattgataataacattcaaagtaaaacaaataacttaaacatagatcct
agaactattctttggaaacgtgttatagatatgaatgatagagctcttagagaggtaact
attggtttgggcggaacagcaaacggaatacctagacaagatggctttaatattactccg
gcatcagaagttatggcaattctttgtatggcttctgatttagaaaatttaaaagaacga
ttgggtaacatttttattggttttacttttgataaaaagcctgtatttgcaagagatttg
aaagccgaaaatgcgatggcaattttattaaaagatgctattaaaccaaatttggtacaa
actttagaagaaaaccctgcaattattcatggcggaccatttgcaaatattgcacaaggt
actaacaccattattgcaactaaaatgggactttctttgtctaattatgttgttacagaa
gctggttttggtgcagatttaggtgcagaaaaatttctaaatattaaatctcagtttgca
gatttaaatcctaaatgtgtagttttagtagctacaattagagctttacgtcatcacggt
ggcgcattaaaagatgcttatgatactgcagatttggcaaaagtaaaaaaaggttttgct
aatttagagaagcatatagaaaatattagaaagtttaatatagaacctgtagttgcaata
aattcttttatttctgattctgaagaagaagttaattttttaattgaaagttgtgctaat
ttaggtgtaaaagcggtcctttctaaaggatgggcaaacggaggagaaggtacaagcgat
ttagcaaaagctgttgtagaagtagtagaaacaaaagcaacacaatacaaacctttgtat
aattggcaatctcctgtaaaagataaaatagaaataattgctaaagaaatttatggtgca
gataaggttgtttacgataacaaagcgctattaaatctaaaaagaattgatagattaggt
tttaatgattttgctgtttgtatggcgaaaacacaaaaatcattttctgataatgataaa
ttaataggtaggcctaaaaactttgtaattacagttcgtgaaattgagatagcagccggt
gcacaatttgttattcctattcttggtaaaatgatgagaatgcctgggttgccttctaaa
cctgcatcagaaaatatgtttatcgataaaaacggagttatttctggattgtcataa

DBGET integrated database retrieval system