KEGG   Polaribacter sp. MED152: MED152_03200Help
Entry
MED152_03200      CDS       T02533                                 

Gene name
hemN1
Definition
(GenBank) oxygen-independent coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
pom  Polaribacter sp. MED152
Pathway
pom00860  Porphyrin and chlorophyll metabolism
pom01100  Metabolic pathways
pom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MED152_03200 (hemN1)
Enzymes [BR:pom01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     MED152_03200 (hemN1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM PTase_Orf2 DUF3880 HemN_C
Motif
Other DBs
NCBI-ProteinID: EAQ41688
UniProt: A2U1I6
Position
complement(675610..676971)
Genome map
AA seq 453 aa AA seqDB search
MKNLIQKYNVPGPRYTSYPTVPYWNNETFSKQKWIKSFQQSFIESNQKEGISLYIHLPFC
ESLCTFCACHKHITKRHEVEEEYIKTVINEWQLYVNLTDETPIIKELHLGGGTPTFFSKE
NLEYLIQGIFKNAKKHNNAEFSFEGHPSNTTKEQLQTLFNCGFTRVSFGVQDYNQNVQKA
INRIQTFKEVQQVTDWAREIGYTSISHDLIFGLPHQTKENVIYTINKTKELKPDRISFYS
YAHVPWVKGVGQRGFNENDLPKDEEKRELYEIGKKLFADLGYEEIGMDHFALKSDSLYKA
TLENTLHRNFMGYTSNKTQLMIGLGMSAISDSWYGFSQNVKTVKEYQKIVNLGEIPVFRG
HILTKEDQIIRKHILNLMCNFSTSWDLDQMKISNVDNHLHELEELIKDDLVQLKGNTIYI
PEKARPFVRNVCMAFDKKLLKVKSDQKTFSLTI
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatttaattcaaaaatataatgttccagggcctagatatacaagttatcctaca
gtaccatattggaataatgaaaccttttctaaacaaaaatggatcaagtcctttcaacaa
tcttttatagaaagtaatcagaaagaaggtattagcttatatattcatttgcctttttgt
gagagtttatgcacgttttgcgcttgtcataaacatattacaaaaagacatgaagtagaa
gaggagtacataaaaacagtaattaacgaatggcaattgtatgttaatttaactgatgaa
actcctattataaaggagttacatttaggtggaggtacacccacatttttctctaaagaa
aatttagagtacttgatacaaggtatttttaaaaatgctaaaaagcacaacaatgctgag
tttagttttgaaggtcatcctagtaatacaaccaaagaacaattacaaacgttgtttaac
tgcggatttaccagagttagctttggagttcaagattataaccaaaatgttcaaaaggca
attaatagaattcaaacttttaaagaagtgcaacaagttacagattgggctagagaaatt
ggttacacctctataagtcatgatttaattttcggtttaccacatcaaacaaaagaaaac
gtaatctataccattaataaaaccaaagagctaaaacctgatcgaatttcattctatagt
tatgcccatgtgccttgggtaaaaggagtagggcagagaggttttaatgaaaatgattta
ccaaaagacgaagaaaaaagagaactgtatgaaataggaaaaaaactatttgcagattta
ggatatgaagaaataggtatggatcattttgcattaaaaagcgattctctctataaagct
actttagaaaatacgttacatagaaactttatgggatatacctcgaataaaacccagtta
atgattggtttgggaatgtctgccatttctgactcttggtatggtttttctcaaaatgta
aaaacagtaaaagaatatcaaaaaatagtgaacttaggagaaattcctgtttttagaggt
catattttaactaaagaagatcaaatcataagaaaacacattttaaatttgatgtgcaac
tttagtacttcttgggatttagaccaaatgaagatttcaaacgttgataatcatttgcat
gaacttgaagagttaataaaagatgatttagttcagttaaaaggcaatactatctatatt
ccagaaaaggcaagaccatttgttagaaacgtatgtatggctttcgacaagaaattacta
aaagtaaaatctgaccaaaaaaccttctcgctaaccatttaa

DBGET integrated database retrieval system