KEGG   Polaribacter sp. MED152: MED152_04060Help
Entry
MED152_04060      CDS       T02533                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
pom  Polaribacter sp. MED152
Pathway
pom00020  Citrate cycle (TCA cycle)
pom00620  Pyruvate metabolism
pom01100  Metabolic pathways
pom01120  Microbial metabolism in diverse environments
pom01200  Carbon metabolism
pom01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MED152_04060
   00620 Pyruvate metabolism
    MED152_04060
Enzymes [BR:pom01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     MED152_04060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 Biotin_lipoyl_2 ATP-grasp_4 RimK HlyD_D23 ATPgrasp_Ter
Motif
Other DBs
NCBI-ProteinID: EAQ41860
UniProt: A2U112
Position
complement(875518..878970)
Genome map
AA seq 1150 aa AA seqDB search
MKIKKVLVANRGEIAIRIFRACAEINVETVGIYTYEDRYSLHRYKSDESYQIGEDNQPLK
PYLDIDAIIKVAKDNGVDAIHPGYGFLSENANFAQKCEENDIIFVGPKVSVLKSLGDKIT
AKKVAIDNNIPIIKSNKNPLESIEIALEEAEKIGYPIMLKAASGGGGRGMRVIRKADELK
KAYGESKREALNAFGDDTVFLEKFVENPKHIEIQIVADSFGNTVHLFERDCSVQRRYQKV
IEFAPSYGLKQETKDALYKYAIDICKAVNYNNIGTVEFLVDDDDSIYFIEVNPRIQVEHT
VTEVVTNIDLVKTQLFIAGGYKLSDQQIKIPNQESIKINGYALQCRITTEDPQNDFKPDF
GTISTYRSASGFGIRLDAGSVYQGVTISPFFDSMLVKVTANSRTLDGAARKIRRALGEFR
IRGVKTNMLFLDNILQHETFRKGAITVNFIKSTPSLFKFKAPRNRANKIITYLGDVTING
NADVKKFDATKTFVKPKIPAFDVNAAYPKGTKDLLTELGPEGFSNWLKNEKKIHFTDTTM
RDAHQSLLATRMRTFDMLKVAEGYAKNHPDIFSLEVWGGATFDVCLRFLHENPWERLRLL
REKMPNVLLQMLIRGSNGVGYTAYPDNLIGKFVEQSWENGVDLFRIFDSLNWMKSIAPCI
EHVRTKTQGLAEGSICYTSDILNVKNTKYNLKYYINLAKEIENAGAHILAIKDMAGLLKP
YAASELVTALKSELNIPIHLHTHDTSSIQSATYLKAIEAGVDVVDVALSGLSGLTSQPNF
NSIVEMMKFHERENPMNATSLNEYSNYWETVREYYYPFESGLKSGSGEVFKHEIPGGQYS
NLKPQAQALGLEGRFHEITKMYGEVNTLFGNIVKVTPSSKVVGDMAQYLVSNNLTIKDVL
ERGDTISFPQSVVSFFKGDLGQPVGGFPEKLQKLILKDQSPYTERPNAHLPPVDFDKEYA
EFRRIFENDLGRKIDFTDFLSYKLYPKVFLDAFNTHLKYDNLTNLPTKNFFYGMEIGEEI
TVDLDKGKTVLITLDSISEANEKGFVTVYFKVNGQGRTVQIKDESIKVTSVQNIKADKNN
SKQIGAPLQGLLSTILVKKGEKVTRNQPLFIIEAMKMETTITANDDGKIDTIILTEGTIV
NADDLVLSLN
NT seq 3453 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattaaaaaagtattagttgcaaatagaggagaaattgctattcgaatttttaga
gcttgtgcagagattaatgtagaaactgttggaatttatacatacgaagatcgctactct
ttgcatagatataaatctgatgaatcttatcaaataggtgaagataatcaacctttaaaa
ccttatttagatattgatgcaataattaaagttgcaaaagataatggagtagatgccatt
catcctgggtatggatttttatctgaaaatgccaattttgctcaaaaatgtgaagaaaac
gatattatttttgtaggaccgaaagtatctgttttaaaatctttaggagataaaattacg
gccaagaaagttgcaatagataataatatacctattataaaaagtaacaaaaacccttta
gaaagtattgagatagctttagaagaggcagaaaaaattggatacccaataatgttgaaa
gctgcttctggaggtggaggtagaggaatgagagttattagaaaagcagatgaacttaaa
aaagcttatggcgaaagtaagagagaagcattaaatgcgtttggagatgacactgttttt
ttagaaaaatttgttgaaaacccgaaacatattgaaattcaaattgttgcagatagtttt
ggtaatacagttcacttatttgagagagattgctctgtgcaaagacgctatcaaaaagta
atagagtttgcaccttcttatggtttaaagcaagaaacaaaagatgcactttacaaatat
gcaatagatatatgtaaagccgtaaattacaataatattggtactgtagaatttttagta
gatgatgatgattcaatttactttatagaggttaatccaagaatacaagtagaacatact
gttacagaagttgtaacaaatatagatttggtgaagacacagctttttattgctggaggt
tataaattatctgatcaacaaataaaaattccgaatcaagagtctattaaaataaacggt
tatgcactgcagtgtagaataactacagaggatccgcaaaatgattttaaaccagatttt
ggaacaatatctacctacagaagtgcttcaggttttggtattcgattagatgcaggtagc
gtttatcaaggtgttacaatatctccgttttttgattctatgttggtaaaagttactgca
aatagtagaactttagatggtgctgctcgtaaaattagaagggctcttggcgaatttcga
attcgtggtgtaaaaactaacatgctttttttagataatatacttcagcacgaaactttt
agaaaaggtgcaattacagtaaactttattaaatctacaccaagtttatttaagtttaaa
gcacctagaaatagagctaataaaataattacttatttgggtgatgttactattaatggc
aatgcagatgttaagaaatttgatgcaacaaaaacatttgtaaaacccaaaattcccgct
tttgatgttaatgcagcttacccaaaaggaacaaaagatttactgacagagttagggcca
gaaggtttttctaattggttgaaaaacgaaaagaaaatacatttcacagacactacaatg
cgtgatgcgcatcaaagtttgttggcaaccagaatgcgaactttcgatatgttaaaagtt
gcagaaggctatgctaaaaaccatccagatatttttagtctggaagtttggggaggtgcc
acttttgatgtttgcttacgatttttacatgaaaatccatgggaaagattacgtttgctt
agagaaaaaatgccaaatgtgctattgcaaatgttaataaggggctctaatggtgttggt
tatactgcctatccagacaatttaattggtaaatttgttgaacaatcttgggaaaatgga
gttgatttattccgaatttttgattctctaaattggatgaaatcgattgctccatgcata
gagcatgtaagaacaaaaacacaaggtttagcagaaggttctatttgttatacctctgat
attttaaatgtaaaaaacactaaatacaatttaaaatattatatcaatttagccaaagaa
attgaaaatgcaggcgcacatattttggcaattaaagatatggctggtttgttaaaacct
tatgcagcttcagaattggttactgctttaaaatcggaattaaacattccaattcacttg
catacacatgacacatcctctatacaatctgccacttatttaaaagcaattgaggcaggt
gtagatgttgtagatgttgcattaagtggcttgtctggtttaacatcgcaaccaaatttt
aactcaattgtagaaatgatgaagtttcacgaaagggaaaaccctatgaatgctacttcc
ttaaatgagtattctaactattgggaaactgtaagagaatattattatccttttgaatct
ggcttaaagtcgggctcaggagaagtatttaaacacgaaattcctggtggccaatattca
aatttaaaaccacaagcacaagctttaggtttagaaggtcgttttcatgaaattacaaaa
atgtatggagaagtaaatacactttttggtaacatcgtaaaagttacaccaagttctaaa
gttgttggtgatatggctcaatatttagtaagtaataatttaactataaaagatgttttg
gaaagaggtgatactatttcttttcctcaatctgtggtgagtttctttaaaggagattta
ggtcagccagttggtggttttccagaaaaattacagaagcttattttaaaagatcaatct
ccctatacagaaagaccaaatgcacatttaccacctgtagattttgataaagaatatgca
gaatttagaagaatatttgaaaatgacttgggtagaaaaattgattttacagatttctta
tcctataaattatatccaaaggtgtttttagatgcttttaatacacatttaaaatacgat
aatctaaccaatttacctaccaaaaatttcttttacggcatggaaataggagaggagatt
actgttgatttagataaaggtaaaactgtattaattacgttagattctattagtgaagct
aatgaaaaaggatttgtaactgtttattttaaagtaaatggacaaggaagaacagtgcag
attaaagatgagtctatcaaagttacatcagttcaaaatataaaagctgataaaaataat
agcaaacaaattggtgcacctttgcaagggttattgtctactattttagttaaaaaagga
gaaaaggtaactagaaatcagcctttatttattattgaagctatgaaaatggaaactaca
attacagccaatgatgatggtaaaattgacactatcatattaactgaaggtacaattgtt
aacgctgatgatttagttttaagcttaaattaa

DBGET integrated database retrieval system