KEGG   Polaribacter sp. MED152: MED152_04175Help
Entry
MED152_04175      CDS       T02533                                 

Definition
(GenBank) pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide acyltransferase (E2) component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pom  Polaribacter sp. MED152
Pathway
pom00020  Citrate cycle (TCA cycle)
pom00310  Lysine degradation
pom00380  Tryptophan metabolism
pom01100  Metabolic pathways
pom01110  Biosynthesis of secondary metabolites
pom01120  Microbial metabolism in diverse environments
pom01130  Biosynthesis of antibiotics
pom01200  Carbon metabolism
Module
pom_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pom_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MED152_04175
  09105 Amino acid metabolism
   00310 Lysine degradation
    MED152_04175
   00380 Tryptophan metabolism
    MED152_04175
Enzymes [BR:pom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     MED152_04175
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: EAQ41883
UniProt: A2U0Y8
Position
complement(897781..899118)
Genome map
AA seq 445 aa AA seqDB search
MARFELKLPKMGESVAEATITSWLKEVGDTIELDEAVVEIATDKVDSEVPSEVEGTLVEI
LFEKDEVVAVGETIAVIETEGGDANNNAGANTSASAPNKEEIKPQEVAEVEKTIEKASEI
LAAPIAKTSDSGKFYSPLVRNIAQTEGISMDELENISGTGKDGRVTKDDILSYIENKDNA
PQKQEVAKPKVASKPSDKPVAKAAPVSVNGEDEIIEMSRMGKLISKHMVDSVQTSAHVQS
FIEIDVTNIVKWRSKVKDAYFKREGEKLTFTPILMQAVASTIKKYPLINIAVDGDKIIKK
KNINLGMAAALPDGNLIVPVIKNADQLNLVGMTKSVNDLANRARNNALKPDEIQGGTYTV
TNVGSFGSVMGTPIINQPQVAILALGAIRKVPAVIETPEGDFIGIRQKMFVSHSYDHRVV
NGALGGMFIKTLKETLEAWDVNQDF
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atggcaagatttgaattaaagttaccaaaaatgggagaaagtgttgcagaagcaacaatt
acttcttggttaaaagaggtaggagatactattgaattggatgaagctgttgttgaaatt
gctacggataaagtagattctgaagtaccttctgaagttgaaggaactttagttgaaatt
ttatttgagaaagatgaggttgttgcagtaggagaaactattgcagttatagaaacagaa
ggaggagatgcaaataacaatgctggtgccaatacttctgcatctgcaccaaataaagaa
gagataaagcctcaagaagttgctgaagttgaaaaaactattgaaaaagcctcagaaatt
ctagctgcaccaattgcaaaaacttcagattctggaaaattttactctccattagtaaga
aatattgctcaaacagaaggtatttctatggatgagttagagaatatttcaggaacaggt
aaggatggtagagttacgaaagatgatattttatcttatatagaaaataaagacaatgct
ccacaaaagcaagaagtagctaagccaaaggttgcttcaaaaccttctgataagcctgta
gctaaggctgcaccagtttctgtaaatggagaagatgaaattatcgaaatgtctagaatg
ggtaaacttatttctaaacatatggtagattctgtacaaacttctgcgcatgtgcaatct
tttatagaaattgatgttaccaatattgttaagtggagaagtaaggtaaaagatgcttat
tttaaaagagaaggtgaaaagttaacatttacaccaattttaatgcaagctgttgcttct
acaataaaaaaatatcctttgataaacattgctgttgatggtgataagattatcaaaaag
aaaaatataaacttaggtatggctgctgctttacctgatggaaatttaattgtacccgta
attaaaaacgcagatcaattgaatttggtgggcatgactaaatctgtaaatgatttagca
aatagagcgagaaacaacgctttgaaaccagatgaaattcaaggaggaacttatacagta
actaatgtaggtagttttggttctgtaatgggtacaccaattattaatcagccgcaagtt
gctattttagctttaggtgcaattcgtaaagtacctgcagttatcgaaactccagaaggt
gattttattggaattagacaaaaaatgtttgtctcacattcttacgatcacagagttgta
aacggtgcacttggtggtatgtttattaaaacattaaaagaaactttagaagcttgggat
gtaaatcaagatttctaa

DBGET integrated database retrieval system