KEGG   Pongo abelii (Sumatran orangutan): 100172513Help
Entry
100172513         CDS       T01416                                 

Gene name
SPHK2
Definition
(RefSeq) sphingosine kinase 2
  KO
K04718  sphingosine kinase [EC:2.7.1.91]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00600  Sphingolipid metabolism
pon01100  Metabolic pathways
pon04020  Calcium signaling pathway
pon04071  Sphingolipid signaling pathway
pon04072  Phospholipase D signaling pathway
pon04370  VEGF signaling pathway
pon04371  Apelin signaling pathway
pon04666  Fc gamma R-mediated phagocytosis
pon05152  Tuberculosis
Module
pon_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100172513 (SPHK2)
 Environmental Information Processing
  Signal transduction
   04370 VEGF signaling pathway
    100172513 (SPHK2)
   04371 Apelin signaling pathway
    100172513 (SPHK2)
   04020 Calcium signaling pathway
    100172513 (SPHK2)
   04072 Phospholipase D signaling pathway
    100172513 (SPHK2)
   04071 Sphingolipid signaling pathway
    100172513 (SPHK2)
 Organismal Systems
  Immune system
   04666 Fc gamma R-mediated phagocytosis
    100172513 (SPHK2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    100172513 (SPHK2)
Enzymes [BR:pon01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphingosine kinase
     100172513 (SPHK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAGK_cat
Motif
Other DBs
NCBI-GeneID: 100172513
NCBI-ProteinID: NP_001125597
Ensembl: ENSPPYG00000010207
UniProt: Q5RB28
Position
19
AA seq 244 aa AA seqDB search
MNGHLEAEEQQDQRLDQELTGSWGHRPRSTLVRAKAMAPPPPPLAASTPLLHSEFGSYPA
RGPRFALTLTSQALHIQRLRPKPEARPRGGLVPLAEVSGCCTLRSRSPSDSAAYFCIYTY
PRGRRGARRRATRTFRADGAATYEENRAEAQRWATALTCLLRGLPLPGDGEITPDLLPRP
PRLLLLVNPFGGRGLAWQWCKNHVLPMISEAGLSFNLIQTERQNHARELVQGLSLSAERA
PRSP
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atgaatggacaccttgaagcagaggagcagcaggaccagaggttggaccaggagctgacc
gggagctggggccacaggcctaggagcaccctggtcagggctaaggccatggccccgccc
ccaccgccactggctgccagcaccccgctcctccatagcgagtttggctcctacccagcc
cgaggcccacgctttgccctcaccctcacatcgcaggccctgcacatacagcggctgcgc
cccaaacccgaagccaggccccggggtggcctggtcccgttggccgaggtctcaggctgc
tgcaccctgcgaagccgcagcccctcagactcagcggcctacttctgcatctacacctac
cctcggggccggcgcggggcccggcgcagagccactcgcaccttccgggcagatggggcc
gccacctacgaagaaaaccgtgccgaggcccagcgctgggccaccgccctcacctgtctg
ctccgaggactgccactgcccggggatggggagatcacccctgacctgctacctcggcct
ccccggttgctcctattggtcaatccctttggggggcggggcctggcctggcagtggtgt
aagaaccacgtgcttcccatgatctctgaagctgggctgtccttcaacctcatccagaca
gaacgacagaaccacgcccgggagctggtccaggggctgagcctgagtgctgaacgggct
cctagatcgccctga

DBGET integrated database retrieval system