KEGG   Pongo abelii (Sumatran orangutan): 100172520Help
Entry
100172520         CDS       T01416                                 

Gene name
PHB2
Definition
(RefSeq) prohibitin-2
  KO
K17081  prohibitin 2
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:pon03029]
    100172520 (PHB2)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:pon04147]
    100172520 (PHB2)
Mitochondrial biogenesis [BR:pon03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Mitochondrial movement
    100172520 (PHB2)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100172520 (PHB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Band_7 Med2 DUF2605
Motif
Other DBs
NCBI-GeneID: 100172520
NCBI-ProteinID: NP_001125603
Ensembl: ENSPPYG00000004214
UniProt: Q5RB19
Position
12
AA seq 299 aa AA seqDB search
MAQNLKDLAGRLPAGPRGMGTALKLLLGAGAVAYGVRESVFTVEGGHRAIFFNRIGGVQQ
DTILAEGLHFRIPWFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSM
YQRLGLDYEERVLPSIVNEVLKSVVAKFNASQLITQRAQVSLLIRRELTERAKDFSLILD
DVAITELSFSREYTAAVEAKQVAQQEAQRAQFLVEKAKQEQRQKIVQAEGEAEAAKMLGE
ALSKNPGYIKLRKIRAAQNISKTIATSQNRIYPTADNLVLNLQDESFTRGSDSLIKGKK
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggcccagaacttgaaggacttggcgggacggctgcccgccgggccccggggcatgggc
acggccctgaagctgttgctgggggccggcgccgtggcctacggtgtgcgcgaatccgtg
ttcaccgtggaaggcgggcacagagccatcttcttcaatcggatcggtggagtgcagcag
gacactatcctggccgagggccttcacttcaggatcccttggttccagtaccccattatc
tatgacattcgggccagacctcgaaaaatctcctcccctacaggctccaaagacctacag
atggtgaatatctccctgcgagtgttgtctcgaccgaatgctcaggagcttcctagcatg
taccagcgcctagggctggactatgaggaacgagtgttgccgtccattgtcaacgaggtg
ctcaagagtgtggtggccaagttcaatgcctcgcagctgatcacccagcgggcccaggta
tccctgttgatccgccgggagctgacagagagggccaaggacttcagcctcatcctggat
gatgtggccatcacagagctgagctttagccgagagtacacagctgctgtagaagccaaa
caagtggcccagcaggaggcccagcgggcccaattcttggtagaaaaagcaaagcaggaa
cagcggcagaagattgtgcaggctgagggtgaggccgaggctgccaagatgcttggagaa
gcactgagcaagaaccctggctacatcaaacttcgcaagattcgagcagcccagaatatc
tccaagacgatcgccacatcacagaatcgtatctatcccacggctgacaaccttgtgctg
aacctacaggatgaaagtttcaccagaggaagtgacagcctcatcaagggtaagaaatga

DBGET integrated database retrieval system