KEGG   Pongo abelii (Sumatran orangutan): 100172618Help
Entry
100172618         CDS       T01416                                 

Gene name
USP11
Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 11 isoform X1
  KO
K11835  ubiquitin carboxyl-terminal hydrolase 4/11 [EC:3.4.19.12]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     100172618 (USP11)
Peptidases [BR:pon01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100172618 (USP11)
Ubiquitin system [BR:pon04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    100172618 (USP11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UCH UCH_1 DUSP Ubiquitin_3 USP7_C2 CENP-B_dimeris zf-MIZ Cys_rich_KTR
Motif
Other DBs
NCBI-GeneID: 100172618
NCBI-ProteinID: XP_024096682
Position
X
AA seq 963 aa AA seqDB search
MAVAPRLFGGLCFRFRDQNPEVAVEGRLPISHSCVGCRGERTAMATVAANPAAAAAAVAA
AAAVAEDKEPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGG
DQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHDMVSWYGLEHGQPPIE
RKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDT
RLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE
DFKGQPGICGLTNLGNTCFMNSALQCLSNVPQLTEYFLNNCYLEELNFRNPLGMKGEIAE
AYADLVKQAWSGHHRSIVPHVFKNKVGHFASQFLGYQQHDSQELLSFLLDGLHEDLNRVK
KKEYVELCDAAGRPDQEVAQEAWQNHKRRNDSVIVDTFHGLFKSTLVCPDCGNVSVTFDP
FCYLSVPLPISHKRVLEVFFIPMDPRRKPEQHRLVVPKKGKISDLCVALSKHTGISPERM
MVADVFSHRFYKLYQLEEPLSSILDRDDIFVYEVSGRIEAIEGSREDIVVPVYLRERTPA
RDYNNSYYGLMLFGHPLLVSVPRDRFTWEGLYNVLMYRLSRYVTKPNSDDEDDGDEKEDD
EEDKDDVPGPSTGGSLRDPEPEQAGPSSGVTNRCPFLLDNCLGTSQWPPRRRRKQLFTLQ
TVNSNGTSDRTTSPEEVHAQPYIAIDWEPEMKKRYYDEVEAEGYVKHDCVGYVMKKAPVR
LQECIELFTTVETLEKENPWYCPSCKQHQLATKKLDLWMLPEILIIHLKRFSYTKFSREK
LDTLVEFPIRDLDFSEFVIQPQNDSNPELYKYDLIAVSNHYGGMRDGHYTTFACNKDSGQ
WHYFDDNSVSPVNENQIESKAAYVLFYQRQDVARRLLSPTGSSGAPASPACSSPPSSEFM
DVN
NT seq 2892 nt NT seq  +upstreamnt  +downstreamnt
atggcagtagccccgcgactgtttggggggctctgcttccgtttccgggaccagaatccg
gaagtggctgttgaggggcgtcttccaatctcgcacagctgcgttggctgtagaggagaa
cggacggcgatggcgacggtcgcagcaaatccagctgctgcggcggcggctgtggcggcg
gcagcggcggtggctgaggataaagagccacagcacgaggaactgccaggcctggacagc
cagtggcgccagatagaaaacggcgagagtggtcgagaacgtccactgcgggccggcgaa
agctggttccttgtggagaagcactggtataagcagtgggaggcatacgtgcagggaggg
gaccaggactccagcaccttccctggctgcatcaacaatgccacactctttcaagatgag
ataaactggcgcctcaaggagggactggtggaaggcgaggattatgtgctgctcccagca
gctgcttggcatgacatggtcagctggtatggtctagagcatggccagccacccattgaa
cgcaaggtcatagagctgcccaacatccagaaggtcgaagtgtacccagtagaactgctg
cttgtccggcacaatgatttgggcaaatctcacactgttcagttcagccataccgattct
attggcctagtattgcgcacagctcgggagcggtttctggtggagccccaggaagacacg
cggctttgggccaagaactcagaaggctctttggataggttgtatgacacacacatcacg
gttctcgatgcggcccttgagactgggcagttgatcatcatggagacccgcaagaaagat
ggcacttggcccagcgcacagctacatgtcatgaacaacaacatgtcggaagaggatgag
gacttcaagggccagccaggcatctgtggcctcaccaatctgggcaacacgtgcttcatg
aactcggccctgcagtgcctcagcaatgtgccacagctcaccgagtacttcctcaacaac
tgctacctggaggagctcaacttccgcaacccactgggcatgaagggtgagatcgcagag
gcctatgcagacctggtgaagcaggcgtggtctggccaccaccgctccattgtgccacat
gtgttcaagaacaaggttggccattttgcgtcccaatttctgggctaccagcagcatgac
tctcaggagctgctgtcattcctcctggacgggctgcatgaggaccttaatcgggtgaag
aagaaggagtatgtggagctgtgcgatgctgctgggcggccggatcaggaggtggcacag
gaggcatggcaaaaccacaaacggcggaacgattctgtgattgtggacactttccacggc
ctcttcaagtccacgctggtgtgtcccgattgtggcaatgtatctgtgaccttcgacccc
ttctgctacctcagtgttccactgcctatcagccacaagagggtcttggaggtcttcttt
atccccatggatccgcgccgcaagccagagcagcaccggctcgtggtccccaagaaaggc
aagatctcggatctatgtgtggctctgtccaaacacacgggcatctcgccagagaggatg
atggtggctgatgtcttcagtcaccgcttctataagctctatcagctggaggagcctctg
agcagcatcttggaccgtgatgatatcttcgtctatgaggtgtcaggtcgcattgaggcc
atcgagggctcgagagaggacatcgtggttcctgtctacctgcgggagcgcacccctgcc
cgtgactacaacaactcctactatggcctgatgctttttgggcacccactcctggtatca
gtgccccgggaccgcttcacctgggagggcctgtataatgtcctgatgtaccggctctca
cgctacgtgaccaaacccaactcagatgatgaggacgatggggatgagaaagaagatgac
gaggaggataaagacgacgtacctgggccctcaactgggggcagcctccgagaccctgag
ccagagcaggctgggcccagctctggagtcacgaacaggtgcccgttcctcctggacaat
tgccttggcacatctcagtggcccccaaggcgacgacgcaagcagctgttcaccctgcag
acggtgaactccaatgggaccagcgaccgcacaacctcccctgaagaagtccatgcccag
ccgtacattgctatcgactgggagccagagatgaagaagcgttactatgatgaggtagag
gctgagggctacgtgaagcatgactgtgtcgggtatgtgatgaagaaggctcctgtgcgg
ctgcaggagtgcattgagctcttcaccactgtggagaccctggagaaggaaaacccctgg
tactgcccctcctgcaagcagcaccagctggcaaccaagaagctggacctgtggatgctg
ccagagattctcatcatccacctgaaacgcttttcctacaccaagttctcccgagagaag
ctggacaccctcgtggagtttcctatccgggacctggacttttctgagtttgtcatccag
ccacagaatgactcgaatccagagctgtacaaatatgacctcatcgcggtttccaaccat
tatgggggcatgcgtgatggacactacacaacatttgcctgcaacaaggacagcggccag
tggcactactttgatgacaacagcgtctcccctgtgaatgagaatcagatcgagtccaag
gcagcctatgtcctcttctatcaacgccaggacgtggcgcgacgcctgctgtccccgacc
ggctcatctggcgccccagcctcccctgcctgcagctccccacccagctctgagttcatg
gatgttaattga

DBGET integrated database retrieval system