KEGG   Pongo abelii (Sumatran orangutan): 100172716Help
Entry
100172716         CDS       T01416                                 

Gene name
ARCN1
Definition
(RefSeq) coatomer subunit delta
  KO
K20471  coatomer subunit delta
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100172716 (ARCN1)
Membrane trafficking [BR:pon04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Retrieval pathways
   Coat protein complex I (COP-I)
    100172716 (ARCN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adap_comp_sub Clat_adaptor_s PA28_alpha
Motif
Other DBs
NCBI-GeneID: 100172716
NCBI-ProteinID: NP_001125788
Ensembl: ENSPPYG00000003939
UniProt: Q5RA77 A0A2J8X0V8
Position
11
AA seq 511 aa AA seqDB search
MVLLAAAVCTKAGKAIVSRQFVEMTRTRIEGLLAAFPKLMNTGKQHTFVETESVRYVYQP
MEKLYMVLITTKNSNILEDLETLRLFSRVIPEYCRALEENEISEHCFDLIFAFDEIVALG
YRENVNLAQIRTFTEMDSHEEKVFRAVRETQEREAKAEMRRKAKELQQARRDAERQGKKA
PGFGGFGSSAVSGGSTAAMITETIIETDKPKVAPAPARPSGPSKALKLGAKGKEVDNFVD
KLKSEGETIMSSSMGKRTSEASKMHAPPINMESVHMKIEEKITLTCGRDGGLQNMELHGM
IMLRISDDKYGRIRLHVENEDKKGVQLQTHPNVDKKLFTAESLIGLKNPEKSFPVNSDVG
VLKWRLQTTEESFIPLTINCWPSESGNGCDVNIEYELQEDNLELNDVVITIPLPSGVGAP
VIGEIDGEYRHDSRRNTLEWCLPVIDAKNKSGSLEFSIAGQPNDFFPVQVSFVSKKNYCN
IQVTKVTQVDGNSPVRFSTETTFLVDKYEIL
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgttggcagcagcggtctgcacaaaagcaggaaaggctattgtttctcgacag
tttgtggaaatgacccgaactcggattgagggcttattagcagcttttccaaagctcatg
aacactggaaaacaacatacgtttgttgaaacagagagtgtgagatatgtctaccagcct
atggagaaactgtatatggtactgatcactaccaaaaacagcaacattttagaagatttg
gagaccctaaggctcttctcaagagtgatccctgagtattgccgagccttagaagagaat
gaaatatctgagcactgttttgatttgatttttgcttttgatgaaattgtcgcgctggga
taccgggagaatgttaacttggcacagatcagaaccttcacagaaatggattctcatgag
gagaaggtgttcagagccgtcagagagactcaagaacgtgaagctaaggctgagatgcgt
cgtaaagcaaaggaattacaacaggcccgaagagatgcagagagacagggcaaaaaagca
ccaggatttggcggatttggcagctctgcagtatctggaggcagcacagctgccatgatc
acagagaccatcattgaaactgataaaccaaaagtggcacctgcaccagccaggccttca
ggccccagcaaggctttaaaacttggagccaaaggaaaggaagtagataactttgtggac
aaattaaaatctgaaggtgaaaccatcatgtcctctagtatgggcaaacgtacttctgaa
gcaagcaaaatgcacgctccacccattaatatggaaagtgtacatatgaagattgaagaa
aagataacattaacctgtggacgagacggaggattacagaatatggagttgcatggcatg
atcatgcttaggatctcagatgacaagtatggccgaattcgtcttcatgtggaaaatgaa
gataagaaaggggtgcagctacagacccatccaaatgtggataaaaaacttttcactgca
gagtctctaattggcctgaagaatccagagaagtcatttccagtcaacagtgacgtaggg
gtgctaaagtggagactacaaaccacagaggaatcttttattccactgacaattaattgc
tggccctcggagagtggaaatggctgtgatgtcaacatagaatatgagctacaagaagat
aatttagaactgaatgacgtggttatcaccatcccactgccgtctggtgtcggcgcgcct
gttatcggtgagatcgatggggagtatcggcatgacagtcgacgaaataccctggaatgg
tgcctgcctgtgattgatgccaaaaataagagtggcagcctggagtttagcattgctggg
cagcccaatgacttcttccctgttcaagtttcctttgtctccaagaaaaattactgtaac
atacaggttaccaaagtgacccaggtagatggaaacagccctgtcaggttttccacagag
accactttcctagtggataagtatgaaatcctgtaa

DBGET integrated database retrieval system