KEGG   Pongo abelii (Sumatran orangutan): 100172871Help
Entry
100172871         CDS       T01416                                 

Gene name
GYS1
Definition
(RefSeq) glycogen [starch] synthase, muscle
  KO
K00693  glycogen synthase [EC:2.4.1.11]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00500  Starch and sucrose metabolism
pon01100  Metabolic pathways
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04910  Insulin signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
Module
pon_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:pon00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100172871 (GYS1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    100172871 (GYS1)
   04152 AMPK signaling pathway
    100172871 (GYS1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    100172871 (GYS1)
   04922 Glucagon signaling pathway
    100172871 (GYS1)
 09160 Human Diseases
  09167 Endocrine and metabolic diseases
   04931 Insulin resistance
    100172871 (GYS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:pon01003]
    100172871 (GYS1)
Enzymes [BR:pon01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100172871 (GYS1)
Glycosyltransferases [BR:pon01003]
 Polysaccharide
  Storage polysaccharide
   100172871 (GYS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycogen_syn Glycos_transf_1 Glyco_transf_4 Glyco_trans_1_4 Glyco_transf_5 Glyco_trans_4_4
Motif
Other DBs
NCBI-GeneID: 100172871
NCBI-ProteinID: NP_001125937
Ensembl: ENSPPYG00000010224
UniProt: Q5R9H0
Position
19
AA seq 737 aa AA seqDB search
MPLNRTLSMSSLPGLEDWEDEFDLENAVLFEVAWEVANKVGGIYTVLQTKAKVTGDEWGA
NYFLVGPYTEQGVRTQVELLEAPTPALKRTLDSMNSKGCKVYFGRWLIEGGPLVVLLDVG
ASAWALERWKGELWDTCNIGVPWYDREANDAVLFGFLTTWFLGEFLAQSEEKLHVVAHFH
EWLAGIGLCLCRARRLPVATIFTTHATLLGRYLCAGAVDFYNNLENFNVDKEAGERQIYH
RYCMERAAAHCAHVFTTVSQITAIEAQYLLKRKPDIVTPNGLNVKKFSAMHEFQNLHAQS
KARIQEFVRGHFYGHLDFNLDKTLYFFIAGRYEFSNKGADVFLEALARLNYLLRVNGSEQ
TVVAFFIMPARTNNFNVETLKGQAVRKQLWDTANTVKEKFGRKLYESLLVGSLPDMNKML
DKEDFTMMKRAIFATQRQSFPPVCTHNMLDDSSDPILTTIRRIGLFNSSADRVKVIFHPE
FLSSTSPLLPVDYEEFVRGCHLGVFPSYYEPWGYTPAECTVMGIPSISTNLSGFGCFMEE
HIADPSAYGIYILDRRFRSLDDSCSQLTSFLYSFCQQSRRQRIIQRNRTERLSDLLDWKY
LGRYYMSARHMALSKAFPEHFTYEPNEADAAQGYRYPRPASVPPSPSLSRHSSPHQSEDE
EDPRNGPLEEDGERYDEDEEAAKDRRNIRAPEWPRRASCTSSTSGSKRNSVDTATSSSLS
TPSEPLSPTSSLGEERN
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgcctttaaaccgcactttgtccatgtcctcactgccaggactggaggactgggaggat
gaattcgacctggagaacgcagtgctcttcgaagtggcctgggaggtggctaacaaggtg
ggtggcatctacacggtgctgcagacgaaggcgaaggtgacgggggacgaatggggcgcc
aactacttcctggtggggccgtacacggagcagggcgtgaggacccaggtggaactgctg
gaggcccccaccccggccctgaagaggacactggattccatgaacagcaagggctgcaag
gtgtatttcgggcgctggctgatcgagggaggccctctggtggtgctcctggacgtgggt
gcctcagcttgggccctggagcgctggaagggagagctctgggatacctgcaacatcggg
gtgccgtggtacgaccgcgaggccaacgacgctgtcctctttggctttctgaccacctgg
ttcctgggtgagttcctggcgcagagtgaggagaagctacacgtggttgctcacttccat
gagtggttggcaggcattggactctgcctgtgtcgtgcccggcgactgcctgtagcaacc
atcttcaccacccatgccacgctgctggggcgctacctgtgtgccggtgccgtggacttc
tacaacaacctggagaacttcaacgtggacaaggaagcaggggagaggcagatctatcac
cgctactgcatggaaagggcggcagcccactgcgctcacgtcttcactactgtgtcccag
atcaccgccatcgaggcacagtacttgctcaagaggaaaccagatattgtgacccccaat
gggctgaatgtgaagaagttttctgccatgcatgagttccagaacctccatgctcagagc
aaggctcgaatccaggagtttgtgcggggccatttttatgggcatctggacttcaacttg
gacaagaccttgtacttctttatcgccggccgctatgagttctccaacaagggtgccgac
gtcttcctggaggccttggctcggctcaactatctgctcagagtgaacggcagcgagcag
acagtggttgccttcttcatcatgccagcgcggaccaacaatttcaacgtggaaaccctc
aaaggccaagccgtgcgcaaacagctttgggacacagccaacacggtgaaggaaaagttc
gggaggaagctttacgaatccttactggttgggagccttcccgacatgaacaagatgctg
gataaggaagacttcactatgatgaagagagccatctttgcaacgcagcggcagtctttc
ccccctgtgtgcacccacaatatgctggatgactcctcagaccccatcctgaccaccatc
cgccgaatcggcctcttcaatagcagtgccgacagggtgaaggtgattttccacccggag
ttcctctcctccacaagccccctgctccctgtggactatgaggagtttgtccgtggctgt
caccttggagtcttcccctcctactatgagccttggggctacacgccagctgagtgcacg
gttatgggaatccccagtatctccaccaatctctccggcttcggctgcttcatggaggaa
cacatcgcagacccctcagcttacggtatctacattctcgaccggcggttccgcagcctg
gatgattcttgctcgcagctcacctccttcctctacagcttctgtcagcagagccggcgg
cagcgtatcatccagcggaaccgcacggagcgcctctccgaccttctggactggaaatac
ctaggccggtactatatgtctgcgcgccacatggcgctgtccaaggcctttccagagcac
ttcacctacgagcccaacgaggcggatgcggcccagggttaccgctacccacggccagcc
tcggtgccaccgtcgccctcgctgtcacgacactccagcccgcaccagagtgaggacgag
gaggatccccggaacgggccgctggaggaagacggcgagcgctacgatgaggacgaggag
gccgccaaggaccggcgcaacatccgtgcaccagagtggccgcgccgagcatcctgcacc
tcctccaccagcgggagcaagcgcaactctgtggacacggccacctccagctcactcagc
accccgagcgagcccctcagccccaccagctccctgggcgaggagcgtaactaa

DBGET integrated database retrieval system