KEGG   Pongo abelii (Sumatran orangutan): 100172948Help
Entry
100172948         CDS       T01416                                 

Gene name
TPI1
Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00051  Fructose and mannose metabolism
pon00562  Inositol phosphate metabolism
pon01100  Metabolic pathways
pon01200  Carbon metabolism
pon01230  Biosynthesis of amino acids
Module
pon_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pon_M00002  Glycolysis, core module involving three-carbon compounds
pon_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100172948 (TPI1)
   00051 Fructose and mannose metabolism
    100172948 (TPI1)
   00562 Inositol phosphate metabolism
    100172948 (TPI1)
Enzymes [BR:pon01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100172948 (TPI1)
Exosome [BR:pon04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100172948 (TPI1)
  Exosomal proteins of bladder cancer cells
   100172948 (TPI1)
  Exosomal proteins of melanoma cells
   100172948 (TPI1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-GeneID: 100172948
NCBI-ProteinID: NP_001126005
UniProt: Q5R928
Position
12
AA seq 249 aa AA seqDB search
MAPSRKFFVGGNWKMNGRKQSLGELIGTLNAAKVPADTEVVCAPPTAYIDFARQKLDPKI
AVAAQNCYKVTNGAFTGEISPGMIKDYGATWVVLGHSERRHVFGESDELIGQKVAHALAE
GLGVIACIGEKLDEREAGITEKVVFEQTKVIADNVKDWSKVVLAYEPVWAIGTGKTATPQ
QAQEVHEKLRGWLKSNVSDAVAQSTRIIYGGSVTGATCKELASQPDVDGFLVGGASLKPE
FVDIINAKQ
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atggcgccctccaggaagttcttcgttggggggaactggaagatgaacgggcggaagcag
agcctgggggagctcatcggcactctgaacgcggccaaggtgccggccgacaccgaggtg
gtttgtgctccccctactgcctatatcgacttcgcccggcagaagctagatcccaagatt
gctgtggctgcgcagaactgctacaaagtgactaatggggcctttactggggagatcagc
cctggcatgatcaaagactacggagccacgtgggtggtcctggggcactcagagagaagg
catgtctttggggagtcagatgagctgattgggcagaaagtggcccatgctctggcagag
ggactcggagtaatcgcctgcattggggagaagctagatgaaagggaagctggcatcact
gagaaggttgtttttgagcagacaaaggtcatcgcagataatgtgaaggactggagcaag
gtcgtcctggcctatgagcctgtgtgggccattggtactggcaagactgcaacaccccaa
caggcccaggaagtacacgagaagctccgaggatggcttaagtccaacgtctctgatgcg
gtggctcagagcacccgtatcatttatggaggctctgtgactggggcaacctgcaaggag
ctggccagccagcctgacgtggatggcttccttgtgggtggtgcttccctcaagcccgaa
ttcgtggacatcatcaatgccaaacaatga

DBGET integrated database retrieval system