KEGG   Pongo abelii (Sumatran orangutan): 100173106Help
Entry
100173106         CDS       T01416                                 

Gene name
EIF3J
Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J
  KO
K03245  translation initiation factor 3 subunit J
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon03013  RNA transport
Brite
KEGG Orthology (KO) [BR:pon00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100173106 (EIF3J)
Ribosome biogenesis [BR:pon03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    100173106 (EIF3J)
Translation factors [BR:pon03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100173106 (EIF3J)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit DUF5093
Motif
Other DBs
NCBI-GeneID: 100173106
NCBI-ProteinID: NP_001126147
Ensembl: ENSPPYG00000006431
UniProt: Q5R8D1 A0A2J8S4C4
Position
15
AA seq 259 aa AA seqDB search
MAAAAAAAAGDSDSWDADAFSVEDPVRKVGGGGTAGGDRWEGEDEDEDVKDNWDDDDDEK
KEEAEVKPEVKISEKKKIAEKIKEKERQQKKRQEEIKKRLEEPEEPKVLTPEEQLADKLR
LKKLQEESDLELAKETFGVNNTVYGIDAMNPSSRDDFTEFGKLLKDKITQYEKSLYYASF
LEVLVRDVCISLEIDDLKKITNSLTVLCSEKQKQEKQSKAKKKKKGVVPGGGLKATMKDD
LADYGGYDGGYVQDYEDFM
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggcggcggcggcggcggcgggggactcggactcctgggacgccgacgcgttc
tccgtggaagacccagtgcggaaggtggggggcggcggcactgccggcggggaccgctgg
gaaggcgaggacgaggacgaggacgtcaaggataactgggatgacgatgatgatgaaaaa
aaagaggaagcagaagtaaaaccagaggtaaaaatttcagaaaagaaaaaaatagcagag
aagataaaagagaaagaacggcaacagaagaaaaggcaagaagaaattaaaaagaggtta
gaagaacctgaagaacctaaagtgctaacaccagaagaacaattagcagataaacttcgg
ctaaagaaattacaggaagagtcagacctcgaattagcaaaggaaacttttggtgttaat
aatacagtttatggaatagatgctatgaacccatcttcaagagatgactttacagagttt
ggaaagttactaaaagataaaattacacaatatgaaaagtcactatattatgccagtttt
ttggaagtcttagttcgagatgtgtgtatttcattggaaattgatgacttgaaaaaaatt
accaattcactgactgtgctttgcagtgaaaaacagaagcaagaaaagcaaagcaaagcc
aaaaagaagaagaaaggtgtggttcctggagggggattaaaagccaccatgaaagatgat
ctggcagattatggtggttatgatggaggatatgtacaagactatgaagacttcatgtga

DBGET integrated database retrieval system