KEGG   Pongo abelii (Sumatran orangutan): 100173254Help
Entry
100173254         CDS       T01416                                 

Gene name
DDX18
Definition
(RefSeq) ATP-dependent RNA helicase DDX18
  KO
K13179  ATP-dependent RNA helicase DDX18/HAS1 [EC:3.6.4.13]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:pon03041]
    100173254 (DDX18)
   03009 Ribosome biogenesis [BR:pon03009]
    100173254 (DDX18)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.13  RNA helicase
     100173254 (DDX18)
Spliceosome [BR:pon03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   RNA helicase-like proteins
    100173254 (DDX18)
Ribosome biogenesis [BR:pon03009]
 Eukaryotic type
  90S particles
   Helicases
    100173254 (DDX18)
  Pre-60S particles
    100173254 (DDX18)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DEAD Helicase_C DUF4217 ResIII
Motif
Other DBs
NCBI-GeneID: 100173254
NCBI-ProteinID: NP_001126280
Ensembl: ENSPPYG00000012796
UniProt: Q5R7S3
Position
2B
AA seq 670 aa AA seqDB search
MSHLPMKLLRKKIEKRNLKLRQRNLKLQGASNLTLSETQNGDVSEETMGSRKVKKSKQKP
MNVSLSETQNGDMPQEAVENIKVKKSPQKSTVLTNGEAAMQSPNSESKKKKKKKRKMVND
AEPDTKKAKTENKGQPEEESAETPKETENNVEKPDNDEDESEVPSLPLGLTGAFEDTSFA
SLCNLVNENTLKAIKEMGFTNMTEIQHKSIRPLLEGRDLLAAAKTGSGKTLAFLIPAVEL
IVKLRFMPRNGTGVLILSPTRELAMQTFGVLKELMTHHVHTYGLIMGGSNRSAEAQKLAN
GINIIVATPGRLLDDMQNTPGFMYKNLQCLVIDEADRILDVGFEEELKQIIKLLPTRRQT
MLFSATQTRKVEDLARISLKKEPLYVGVDDDKANATVDGLEQGYVVCPSEKRFLLLFTFL
KKNRKKKLMVFFSSCMSVKYHYELLNYIDLPVLAIHGKQKQNKRTTTFFQFCNADSGTLL
CTGVAARGLDIPEVDWIVQYDPPDDPKEYIHRVGRTARGLNGRGHALLILRPEELGFLRY
LKQSKVPLSEFDFSWSKISDIQSQLEKLIEKNYFLHKSAQEAYKSYIRAYDSHSLKQIFN
VNNLNLPQVALSFGFKVPPFVDLNINSNEGKQKKRGGGGGFGYQKTKKVEKSKIFKHISK
KSSDSRQFSH
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
atgtctcacctgccgatgaaactcctgcgtaagaagatcgagaagcggaacctcaaattg
cggcagcggaacctaaagttgcagggggcctcaaatctgaccctatcagaaactcaaaat
ggagatgtatctgaagaaacaatgggaagtagaaaggttaaaaaatcaaaacaaaagccc
atgaatgtgagcttatcagaaactcaaaatggagacatgcctcaagaagcagtagaaaat
ataaaagttaaaaaatctccccagaaatccactgtattaaccaatggagaagcagcaatg
cagtctcccaattcagaatcaaaaaagaaaaagaagaaaaagagaaaaatggtgaatgat
gctgagcctgatacaaaaaaagcaaaaactgaaaacaaagggcaacctgaagaagaaagt
gccgagactcctaaagaaacagagaataatgtggagaagccagataatgatgaagatgag
agtgaggtgcccagtctgcccctgggactgacaggagcttttgaggatacttcgtttgct
tctctatgtaatcttgtcaatgaaaacaccctgaaggcaataaaagaaatgggttttaca
aacatgactgaaattcagcataaaagtatcagaccacttctggaaggcagggatcttcta
gcagctgcaaaaacaggcagtggtaaaaccctggcttttctcatccctgcggttgaactc
attgttaagctaaggttcatgcccaggaatggaacaggagtccttattctctcacctact
agagaactagccatgcaaacttttggtgttcttaaggagctaatgactcaccacgtgcat
acctatggcttgataatgggtggcagtaacagatctgctgaagcacagaaacttgctaat
gggatcaacatcattgtggccacaccaggccgtctgctggacgatatgcagaatacccca
ggatttatgtataaaaacctgcagtgtctggttattgatgaagctgatcgtatcttggat
gtggggtttgaagaggaattaaagcaaattattaaacttttgccaacacgtagacagact
atgctcttttctgccacccaaactcgaaaagttgaagacctggcaaggatttctctgaaa
aaggagccattgtatgttggtgtcgatgatgataaagctaatgcaacagtggatggtctt
gagcagggatatgttgtttgtccttctgaaaagagattccttctgctctttacattcctt
aagaagaaccgaaagaagaagcttatggtcttcttttcatcttgtatgtctgtgaaatac
cactatgagttgctgaactacattgatttgcccgtcttggccattcatggaaagcaaaag
caaaataagcgtacaaccacattcttccagttctgcaatgcagattcgggaacactgttg
tgtacaggtgtggcagcaagaggactggacattcctgaagtcgactggattgttcagtat
gaccctccggatgaccctaaggaatatattcatcgtgtgggtagaacagccagaggccta
aatggaagagggcatgccttgctcattttgcgcccagaagaattgggttttcttcgctac
ttgaaacaatccaaggttccattaagtgaatttgacttttcctggtctaaaatttctgac
attcagtctcagcttgagaaattgattgaaaagaattactttcttcataagtcagcccag
gaagcatataagtcatacatacgagcctatgattcccattctctgaaacagatctttaat
gttaataacttaaatttgcctcaagttgctctgtcatttggcttcaaggtgcctcccttc
gttgatctgaacatcaacagcaatgaaggcaagcagaaaaagcgaggaggtggtggtgga
tttggctaccagaaaaccaagaaagttgagaagtccaaaatctttaaacacattagcaag
aaatcatccgacagcaggcagttctctcactga

DBGET integrated database retrieval system