KEGG   Pongo abelii (Sumatran orangutan): 100173512
Entry
100173512         CDS       T01416                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 precursor
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:pon01002]
    100173512 (ERAP1)
Enzymes [BR:pon01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     100173512 (ERAP1)
Peptidases and inhibitors [BR:pon01002]
 Metallo peptidases
  Family M1
   100173512 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N FPV060
Other DBs
NCBI-GeneID: 100173512
NCBI-ProteinID: NP_001126523
Ensembl: ENSPPYG00000015650
UniProt: Q5R6K9
Position
5
AA seq 941 aa
MVFLSLKWSLATMSFLLSSLLALLTVSTPSWCQSSEASPKGSDGTPFPWNKIRLPEYVIP
VHYDLLIHANLTTLTFWGTTEVEITASQPTSTIILHSHHLQISRATLRKGAGKRLSEEPL
QVLEHPPQEQIALLAPEPLLVGLPYTVVIHYAGNLSETFHGFYKSTYRTKEGELRILAST
QFEPTAARMAFPCFDEPAFKASFSIKIRREPSHLAISNMPLVKSVTVAEGLIEDHFDVTV
KMSTYLVAFIISDFESVSKMTKRGVKVSVYAVPDKINQADYALDAAVTLLEFYEDYFSIP
YPLPKQDLAAIPDFQSGAMENWGLTTYRESTLLFDAEKSPASSKLGITMIVAHELAHQWF
GNLVTMEWWNDLWLNEGFAKFMEFVSVSVTHPELKVGDYFFGKCFDAMEVDALNSSHPVS
TPVENPAQIREMFDDVSYDKGACILNMLMEYLGADAFKSGIVQYLQKHSYKNTKNEDLWD
SMASICPTDGVKGVDGFCSRSQHSSSSSHWHQEGLDVKTMMNTWTLQKGFPLITITVRGR
NVHMKQEHYMKGSDGAPDTGYLWHVPLTFITSKSDMVHRFLLKTKTDVLILPEEVEWIKF
NVDMNGYYIVHYEDDGWDSLTGLLKGTHTAVSSNDRASLINNAFQLVSIGKLSIEKALDL
SLYLKHETEIMPVFQGLNELIPMYKLMEKRDMNEVETQFKAFLIRLLRDLIDKQTWTDEG
SVSERMLRSQLLLLACVRKYQPCVQRAEGYFRKWKESNGNLSLPVDVTLAVFAVGAQSTE
GWDFLYSKYQFSLSSTEKNQIEFALCTTQNKEKLQWLLDESFKGDKIKAQEFPEILILIG
RNPVGYPLAWQFLRKNWNKLVQKFELGSASIAHMVMGTTNQFSTRTRLEEVKGFFSSLKE
NGSQLRCVQQTIETIEENIRWMGKNFDKIRVWLQSEKLELL
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtgtttctgtccctcaaatggtcccttgcaaccatgtcatttctactttcctcactg
ttggctctcttaactgtgtccactccttcatggtgtcagagcagtgaagcatctccaaaa
ggtagtgatgggacgccatttccttggaataaaatacgacttcctgagtacgtcatccca
gttcattatgatctcttgatccatgcaaaccttaccacgctgaccttctggggaaccacg
gaagtagaaatcacagccagtcagcccaccagcaccatcatcctgcatagtcaccacctg
cagatatctagggccaccctcaggaagggagctggaaagaggctatcggaagaacccctg
caggtcctggaacacccccctcaggagcaaatcgcgctgctggctcccgagcccctcctt
gtcgggctcccgtatacagttgtcattcactatgctggcaatctttcggagactttccac
ggattttacaaaagcacctacagaaccaaggaaggggaactgaggatacttgcatcaaca
caatttgaacccactgcagctagaatggcctttccctgctttgatgaacctgccttcaaa
gcaagtttctcaatcaaaattagaagagagccaagccacctagccatctccaatatgcca
ttggtgaaatctgtgactgttgctgaaggactcatagaagaccattttgatgtcactgtg
aagatgagcacctatctggtggccttcattatttcagattttgagtctgtcagcaagatg
accaagagaggagtcaaggtgtctgtatatgctgtgccagacaagataaatcaagcagat
tatgcactggatgctgcggtgactcttctagaattttatgaggactatttcagcataccg
tatcccctacccaaacaagatcttgctgctattcctgactttcagtctggtgctatggaa
aactggggactgacaacatatagagaatctactctattgtttgatgcagaaaagtctcct
gcatcaagtaagcttggcatcacaatgattgtggcccatgaactggcccaccagtggttt
gggaacctggtcactatggaatggtggaatgatctttggctaaatgagggatttgccaaa
tttatggagtttgtgtctgtcagtgtgacccatcctgaactgaaagttggagattatttc
tttggcaaatgttttgacgcaatggaggtagatgctttaaattcctcacaccctgtgtct
acacctgtggagaatcctgctcagatccgggagatgtttgatgatgtttcttatgataag
ggagcttgtattctgaatatgctaatggagtatcttggtgctgatgcatttaaaagtggt
attgtacagtatctccagaagcatagctataaaaatacaaaaaacgaggacctgtgggat
agtatggcaagtatttgccctacagatggtgtaaaaggggtggatggcttttgctctaga
agtcaacattcatcttcatcctcacattggcatcaggaagggctggatgtgaaaaccatg
atgaacacttggacactgcagaagggttttcccctgataaccatcacagtgagggggagg
aacgtacacatgaagcaagagcactacatgaagggctctgatggcgccccggacactggg
tacctgtggcatgttccattgacattcatcaccagcaaatcagacatggtccatcgattt
ttgctaaaaacaaaaacagatgtgctcatcctcccagaagaggtggaatggatcaaattt
aatgtggacatgaatggctattacattgtgcattacgaggatgatggatgggactctttg
accggccttttaaaaggaacacacacagcagtcagcagtaatgatcgggcgagtctcatt
aacaatgcatttcagctcgtcagcattgggaagctgtccattgaaaaggccttggattta
tccctgtacttgaaacatgaaactgaaattatgcccgtgtttcaaggtttgaatgagctg
attcctatgtataagttaatggaaaaaagagatatgaatgaagtggaaactcaattcaag
gccttcctcatcaggctgctaagggacctcattgataagcagacgtggacagacgagggc
tcagtctcagagcgaatgctgcggagtcaactactcctcctcgcctgtgtgcgcaagtat
cagccgtgcgtacagagggcagaaggctatttcagaaagtggaaggaatccaatggaaac
ttgagcctgcctgttgacgtgaccttggcagtgtttgctgtgggggcccagagcacagaa
ggctgggattttctttatagtaaatatcagttttctttgtccagtactgagaaaaaccaa
attgaatttgccctctgcacaacccaaaataaggaaaagcttcaatggctactggatgaa
agctttaagggagataaaataaaagctcaggagtttccagaaattcttatactcattggc
aggaacccagtaggatacccattggcctggcaatttctgaggaaaaactggaacaaactt
gtacaaaagtttgaacttggctcagcttccatagcccacatggtaatgggtacaacaaat
caattctccacaagaacacggcttgaagaggtaaaaggattcttcagctctttgaaagaa
aatggttctcagctccgttgtgtccaacagacaattgaaaccattgaagaaaacatccgt
tggatgggtaagaattttgataaaatcagagtgtggctgcaaagtgaaaagcttgaactt
ctgtaa

DBGET integrated database retrieval system