KEGG   Pongo abelii (Sumatran orangutan): 100173558Help
Entry
100173558         CDS       T01416                                 

Gene name
PFN2
Definition
(RefSeq) profilin-2
  KO
K05759  profilin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04015  Rap1 signaling pathway
pon04810  Regulation of actin cytoskeleton
pon05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:pon00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    100173558 (PFN2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    100173558 (PFN2)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    100173558 (PFN2)
Membrane trafficking [BR:pon04131]
 Others
  Actin-binding proteins
   Others
    100173558 (PFN2)
Cytoskeleton proteins [BR:pon04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Profilin
     100173558 (PFN2)
Exosome [BR:pon04147]
 Exosomal proteins
  Proteins found in most exosomes
   100173558 (PFN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Profilin
Motif
Other DBs
NCBI-GeneID: 100173558
NCBI-ProteinID: NP_001126567
Ensembl: ENSPPYG00000014203
UniProt: Q5R4E2
Position
3
AA seq 140 aa AA seqDB search
MAGWQSYVGNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFF
TNGLTLGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVH
GGGLNKKAYSMAKYLRDSGF
NT seq 423 nt NT seq  +upstreamnt  +downstreamnt
atggccggttggcagagctacgtgggtaacctgatgtgcgatggctgctgccaggaggcc
gccattgtcggctactgcgacgccaaatacgtctgggcagccacggccgggggcgtcttt
cagagcattacgccaatagaaatagatatgattgtaggaaaagaccgggaaggtttcttt
accaacggtttgactcttggcgcgaagaaatgctcagtgatcagagatagtctatacgtc
gatggtgactgcacaatggacatccggacaaagagtcaaggtggggagccaacatacaat
gtggctgtcggcagagctggtagagtcttggtctttgtaatgggaaaagaaggggtccat
ggaggcggattgaataagaaggcatactcaatggcaaaatacttgagagactctgggttc
tag

DBGET integrated database retrieval system