KEGG   Pongo abelii (Sumatran orangutan): 100173760Help
Entry
100173760         CDS       T01416                                 

Gene name
PCK1
Definition
(RefSeq) phosphoenolpyruvate carboxykinase, cytosolic [GTP]
  KO
K01596  phosphoenolpyruvate carboxykinase (GTP) [EC:4.1.1.32]
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon00010  Glycolysis / Gluconeogenesis
pon00020  Citrate cycle (TCA cycle)
pon00620  Pyruvate metabolism
pon01100  Metabolic pathways
pon03320  PPAR signaling pathway
pon04068  FoxO signaling pathway
pon04151  PI3K-Akt signaling pathway
pon04152  AMPK signaling pathway
pon04910  Insulin signaling pathway
pon04920  Adipocytokine signaling pathway
pon04922  Glucagon signaling pathway
pon04931  Insulin resistance
pon04964  Proximal tubule bicarbonate reclamation
Module
pon_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:pon00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100173760 (PCK1)
   00020 Citrate cycle (TCA cycle)
    100173760 (PCK1)
   00620 Pyruvate metabolism
    100173760 (PCK1)
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    100173760 (PCK1)
   04151 PI3K-Akt signaling pathway
    100173760 (PCK1)
   04152 AMPK signaling pathway
    100173760 (PCK1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    100173760 (PCK1)
   04922 Glucagon signaling pathway
    100173760 (PCK1)
   04920 Adipocytokine signaling pathway
    100173760 (PCK1)
   03320 PPAR signaling pathway
    100173760 (PCK1)
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    100173760 (PCK1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100173760 (PCK1)
Enzymes [BR:pon01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.32  phosphoenolpyruvate carboxykinase (GTP)
     100173760 (PCK1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPCK_C PEPCK_N
Motif
Other DBs
NCBI-GeneID: 100173760
NCBI-ProteinID: NP_001126758
Ensembl: ENSPPYG00000011164
UniProt: Q5R5J1
Position
20
AA seq 622 aa AA seqDB search
MPPQLQNGLNLSAKVVQGSLDSLPQAVRKFLENNAELCQPDHIHICDGSEEENGRLLGQM
EEEGILRRLKKYDNCWLALTDPRDVARIGSKTVIVTQEQRDTVPIPKTGLSQLGRWMSEE
DFEKALNARFPGCMKGRTMYVIPFSMGPLGSPLSKIGIELTDSPYVVASMRIMTRMGTPV
LEALGDGEFVKCLHSVGCPLPLQKPLVNNWPCNPELTLIAHLPDRREIISFGSGYGGNSL
LGKKCFALRMASRLAKEEGWLAEHMLILGITNPEGEKKYLAAAFPSACGKTNLAMMNPSL
PGWKVECVGDDIAWMKFDAQGHLRAINPENGFFGVAPGTSVKTNPNAIKTIQKNTIFTNV
AETSDGGVYWEGIDEPLASGVTITSWKNKEWSPEDGEPCAHPNSRFCTPASQCPIIDAAW
ESPEGVPIEGIIFGGRRPAGVPLVYEALSWQHGVFVGAAMRSEATAAAEHKGKIIMHDPF
AMRPFFGYNFGKYLAHWLSMAQHPAAKLPKIFHVNWFRKDKEGKFLWPGFGENSRVLEWM
FNRIDGKAGAKLTPIGYIPKEDALNLKGLGHINVMELFSISKEFWEKEVEDIEKYLEDQV
NADLPCEIEREILALKQRISQM
NT seq 1869 nt NT seq  +upstreamnt  +downstreamnt
atgcctcctcagctgcaaaacggcctgaacctctcggccaaagttgtccagggaagcctg
gacagcctgccccaggcagtgaggaagtttctcgagaataacgctgagctgtgtcagcct
gatcacatccacatctgcgacggctctgaggaggagaatgggcggcttctgggccagatg
gaggaggagggcatcctcaggcggctgaagaagtatgacaactgctggttggctctcact
gaccccagggatgtggccaggatcggaagcaagacggttatcgtcacccaagagcaaaga
gacacagtgcccatccccaaaacaggcctcagccagctcggtcgctggatgtcagaggag
gattttgagaaagcgctcaatgccaggttcccagggtgcatgaaaggtcgcaccatgtat
gtcatcccattcagcatggggccgctgggctcgcctctgtcgaagatcggcatcgagctg
acagattcaccctacgtggtggccagcatgcggatcatgacgcggatgggcacgcccgtc
ctggaagcactgggcgatggggagtttgtcaaatgcctccattctgtggggtgccctctg
cctttacaaaagcctttggtcaacaactggccctgcaacccggagctgacgctcatcgcc
cacctgcctgaccgcagagagatcatctcctttggcagtgggtatggcgggaactcgctg
ctcgggaagaagtgctttgctctcaggatggccagccggctggccaaggaggaaggatgg
ctggcagagcacatgctgattctgggtataaccaaccctgagggtgagaagaagtacctg
gcggccgcatttcccagcgcctgcgggaagaccaacctggccatgatgaaccccagcctc
cccgggtggaaggttgagtgcgtcggggatgacattgcctggatgaagtttgacgcacaa
ggtcatttaagggctatcaacccagaaaatggctttttcggtgtcgctcctgggacttca
gtgaagaccaaccccaatgccatcaagaccatccagaagaacaccatctttaccaatgtg
gccgagaccagcgacgggggcgtttactgggaaggcattgatgagccgctagcttcaggc
gtcaccatcacttcctggaagaataaggagtggagcccagaggatggggaaccttgtgcc
caccccaactccaggttctgcaccccagccagccagtgccccatcattgatgctgcctgg
gagtctccggaaggtgttcccattgaaggcattatctttggaggccgtagacctgctggt
gtccctctagtctatgaagctctcagctggcaacatggagtctttgtgggggcggccatg
agatcagaggccacagcagctgcagaacataaaggcaaaatcatcatgcatgaccccttt
gccatgcggcccttctttggctacaactttggcaaatacctggcccactggcttagcatg
gcccagcacccagcagccaaactgcccaagatcttccatgtcaactggttccggaaggac
aaggaaggcaaattcctctggccaggctttggagagaactccagggtgctggagtggatg
ttcaaccgcatcgatgggaaagccggtgccaagctcacacccataggctacatccccaag
gaggatgccctgaatctgaaaggcctggggcacatcaacgtgatggagctcttcagcatc
tccaaggaattctgggagaaggaggtggaagacatcgagaagtatctggaggatcaggtc
aatgctgacctcccctgtgaaattgagagagagatccttgccttgaagcaaagaataagc
cagatgtaa

DBGET integrated database retrieval system