KEGG   Pongo abelii (Sumatran orangutan): 100174094
Entry
100174094         CDS       T01416                                 

Gene name
TTR
Definition
(RefSeq) transthyretin precursor
  KO
K20731  transthyretin
Organism
pon  Pongo abelii (Sumatran orangutan)
Pathway
pon04918  Thyroid hormone synthesis
Brite
KEGG Orthology (KO) [BR:pon00001]
 09150 Organismal Systems
  09152 Endocrine system
   04918 Thyroid hormone synthesis
    100174094 (TTR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:pon02000]
    100174094 (TTR)
Transporters [BR:pon02000]
 Other transporters
  Others
   100174094 (TTR)
SSDB
Motif
Pfam: Transthyretin
Other DBs
NCBI-GeneID: 100174094
NCBI-ProteinID: NP_001127064
Ensembl: ENSPPYG00000009090
UniProt: Q5NVS2
Position
18
AA seq 147 aa
MASHRLLLLCLAGLVFVSEAGPTGAGESKCPLMVKVLDAVRGSPAVNVAVNVFKRAADET
WEPFASGKTSESGELHGLTTEEEFVEGIYKVEIDTKSYWKALGISPFHEHAEVVFAANDS
GPRRYTIAALLSPYSYSTTAVVTNPKE
NT seq 444 nt   +upstreamnt  +downstreamnt
atggcttctcatcgtctgctcctcctctgccttgctggactggtatttgtgtctgaggct
ggccctacgggcgctggtgaatccaagtgtcctctgatggtcaaagttctagacgctgtc
cgaggcagtcctgccgtcaatgtggctgtgaatgtgttcaaaagggctgctgatgagacc
tgggagccatttgcctctgggaaaaccagtgagtctggagagctgcatgggctcacaact
gaggaggaatttgtagaagggatatacaaagtggaaatagacaccaaatcttactggaag
gcacttggcatctccccattccatgagcatgcagaggtggtattcgcagccaacgactcc
ggcccccgccgctacaccatcgccgccctgctgagcccctactcctattccaccacggct
gtcgtcaccaatcccaaggaatga

DBGET integrated database retrieval system