KEGG   Pongo abelii (Sumatran orangutan): 100174309Help
Entry
100174309         CDS       T01416                                 

Gene name
VPS41
Definition
(RefSeq) vacuolar protein sorting-associated protein 41 homolog
  KO
K20184  vacuolar protein sorting-associated protein 41
Organism
pon  Pongo abelii (Sumatran orangutan)
Brite
KEGG Orthology (KO) [BR:pon00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:pon04131]
    100174309 (VPS41)
Membrane trafficking [BR:pon04131]
 Endosome - Lysosome transport
  Tethering complex
   Hops complex
    100174309 (VPS41)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANAPC4_WD40
Motif
Other DBs
NCBI-GeneID: 100174309
NCBI-ProteinID: NP_001127254
UniProt: Q5RDD4
Position
7
AA seq 420 aa AA seqDB search
MGETEILKRMQASCMTVHDKFLALGTHYGKVYLLDVQGNITQKFDVSPVKINQISLDESG
EHMGVCSEDGKVQVFGLYSGEEFHETFDCPIKIIAVHPHFREDPAVKQFVTGGKKLLLFE
RSWMNRWKSAVLHEGEGNIRSVKWRGHLIAWAHNMGVKIFDIISKQRITNVPRDDISLRP
DMYPCSLCWKDNVTLIIGWGTSVKVCSVKERHASEMRDLPSRYVEIVSQFETEFYISGLA
PLCDQLVVLSYVKEISEKTEREYCARPRLDIIQPLSETCEEISSDALTVRGFQENECRDY
HLEYSEGESLFYIVSPRDVVVAKERDQDDHIDWLLEKKKYEEALMAAEISQKNIKRHKIL
DIGLAYINHLVERGDYDIAARKCQKILGKNAALWEYEVYKFKEIGQLKAISPNCQEVIQF
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgggggaaactgaaatactcaaaaggatgcaagctagctgcatgacagtccatgacaag
tttttggcattgggcacacattatggcaaggtttatttacttgatgtccaggggaacatc
actcagaagtttgatgtaagtcctgtgaagataaatcagatcagcttggatgaaagtgga
gagcacatgggcgtgtgttcagaggatggcaaggtgcaggtatttggactgtattctgga
gaagaatttcacgagacttttgactgtcccattaaaattattgctgtgcacccacatttt
cgtgaggatccagctgttaagcagtttgtgaccggagggaagaagctgctactgtttgaa
cggtcttggatgaacagatggaagtctgctgttctgcatgaaggggaagggaacataagg
agtgtgaagtggagaggccatctgattgcttgggcccataatatgggtgtgaagattttt
gacatcatctcaaagcaaagaatcaccaatgtgccccgggatgatataagtcttcgccca
gacatgtatccctgcagcctctgctggaaggacaatgtgacactgattattggctggggg
acttctgtcaaggtatgctcagtgaaggaacggcatgccagtgaaatgagggatttgcca
agtcgatatgttgaaatagtgtctcagtttgaaactgaattctacatcagtggacttgca
cctctctgtgatcagcttgttgtactttcctatgtaaaggagatttcagaaaagacggaa
agagaatactgtgccaggcctagactggacatcatccagccactttctgagacttgtgaa
gagatctcttctgatgctctgacagtcagaggctttcaggagaatgaatgtagagattat
catttagaatactctgaaggggaatcacttttttacatcgtgagtccgagagatgttgta
gtggccaaggaacgagaccaagatgatcacattgactggctccttgaaaagaagaaatat
gaagaagcattgatggcagctgaaattagccaaaaaaatattaaaagacataagattctg
gatattggcttggcatatataaatcacctggtggagagaggagactatgacatagcagca
cgcaaatgccagaaaattcttgggaaaaatgcagcgctctgggaatatgaagtttataaa
tttaaggaaattggacagcttaaggctataagccctaattgccaagaggtgatccagttc
tga

DBGET integrated database retrieval system